KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2689Help
Entry
Sulac_2689        CDS       T01746                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sulac_2689
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sulac_2689
Enzymes [BR:sap01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Sulac_2689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2653718..2654998)
Genome map
AA seq 426 aa AA seqDB search
MAQFVIEGGHALAGDVTVAGSKNSALPIITAAALAATGDTILENVPRYTDILDLCQILRE
LGARIEWLSESRLAINAEQLTGYQARYDLARKLRGSTYLVGLLLARLGRADVAFPGGCQI
GSRPVNFHIQGFQALGATMWLEHGSIQGTVDGRLQGTRFYVERASFGTTLNLMIAGSLAE
GTTVLENAAMEPEIVDVANFLNAMGAKVRGAGTNLIRIEGVSRLHGTRHEIIPDRLEAGT
YLIAGAVTGGVVTVANVIPEHLTTVLLKLQQSGMTIESDMDWIRLTAPRRPQAVDIETLP
HPGFPTDLHPQMVSLLSIAEGISVVQETVFENRFGYTHDLVRLGADIKLDRDTAIIRGVD
RLTGAPVQAQDIRGGAALVLAGLRAEGLTVVDGVEYIDRGYHAMEEKLSALGAEIVRREL
NPVYDR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcacagtttgtcattgaaggtggacatgcattggcgggtgacgtcaccgtcgccggc
tctaaaaatagtgccttacccatcattaccgccgcggcgcttgccgccaccggcgatacg
attttagaaaacgtgccgcggtatacggacattctggatttatgtcaaatcttgcgcgag
ctgggcgcgcgcatcgagtggctgtcggaatcgcgtctggctattaatgccgaacagttg
acgggataccaggcccgttatgatctggcacgaaagctacgcgggtcgacctatttggtc
ggcctcttgttggctcgactgggtcgcgcggacgtcgcctttccgggcggctgccaaatc
gggtcacggccggtcaattttcatattcagggtttccaggcgttgggggcgaccatgtgg
ctggaacatgggtcgattcagggaacggtcgacggtcggctgcagggaacgcggttttac
gtggagcgcgcatcatttgggaccacattaaacttaatgattgccggtagtttggccgag
ggcaccacggtattggaaaacgcggcgatggagccggaaattgtagacgtcgccaatttc
ttgaatgcgatgggggccaaagtacggggcgccgggacgaatttaatccggatcgaaggc
gtgtcccgtttacacgggacccgacatgaaattatccccgatcggctggaagcgggaacc
tatttaatagccggcgccgtgaccgggggggtggtcacggtggccaacgtgattccggag
cacttgaccaccgtgctgctcaaactgcaacaaagcggcatgacgattgaatccgatatg
gattggattcggcttaccgcgccgcgccgtccacaggcggtcgatatcgaaaccttgcca
catcccggatttccgaccgatttacatccccaaatggtttccttgttatcgattgcggag
ggcatctccgttgtgcaagaaaccgtgtttgaaaatcgcttcgggtatacccacgatttg
gtccggttgggcgccgacattaaactcgatcgcgataccgccattattcggggggtcgac
cgattgacgggggcaccggtacaggcgcaggatattcggggaggggccgccctggtgttg
gcgggactacgggcggaaggcctcaccgtggttgacggggtcgaatatatcgatcgcggt
tatcatgcaatggaagaaaaactctccgccttaggtgcggagattgtccgtcgggagtta
aacccggtttacgatcggtaa

DBGET integrated database retrieval system