KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2734Help
Entry
Sulac_2734        CDS       T01746                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00340  Histidine metabolism
sap01100  Metabolic pathways
sap01110  Biosynthesis of secondary metabolites
sap01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Sulac_2734
Enzymes [BR:sap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Sulac_2734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEW06196
UniProt: G8TXZ0
Position
2691382..2692587
Genome map
AA seq 401 aa AA seqDB search
MSDPLIGDILDAVRDRGVKAVLEYTEAFDHVRLSPDDLIWNPLAEAPAVIDPAVREAVDF
AMDQIRRFHEATRPAPVTVNQAPGLILREVFQPLGRVGLYVPNGQFPLVSSLMMTAIPAQ
VAGVTDLVVAIAPRGHVTSDPVWLYVLQKLGIRQVLRVGGAQAIAALGYGLPGLPPVDLI
AGPGNRYVAWAKQELFRRGVTGIDVIAGPSEVLVISQDTAFAPLVALDLLAQAEHDPDAK
AYLVSWNPDLIAAVKDYIASHVNPADRLGQIEYILVANANEAVQTANRIAPEHLGLIGAE
VEPLWPQLTTAGALFVGRLAGQALGDYVAGPSHVLPTGHTGRFLSGLSTRTFMRRISVIQ
TEDALPAAFLEAGQVLAHLEGLRYHEQSLAVRQQLRGQEGL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccgttaatcggagacattttggacgccgtccgcgatcgcggggtcaaagcc
gtcttagagtacacggaagcctttgatcacgttcggttgtcgcccgacgatttgatttgg
aaccctctcgcagaagccccggccgtcattgatccggccgtccgggaagccgtcgatttt
gccatggatcaaattcgtcgctttcacgaggcaacccgaccggccccggtgaccgtcaac
caagctcccgggctcattctccgcgaggtcttccagcccttaggacgggtgggactttat
gtacccaacggccaatttcctttggtgtccagtttaatgatgaccgccatcccggcccaa
gtcgcgggggtcacggatctggtcgtggccattgccccccggggtcatgtcacgtcggat
ccggtctggctctatgtcctgcagaaactgggcattcgccaagtgttgcgggtgggcggg
gcgcaagccatcgccgcgctcggttacggattgccgggattaccgccggtggacttaatc
gccggtcccgggaaccgctatgtcgcgtgggccaaacaagaactctttcgccgcggggtg
accggcatcgacgtcattgcaggtccgtcggaagtcttggtgataagccaagatacggct
ttcgcacctttggtcgccttggatttgttggctcaggcggaacacgaccccgacgcgaaa
gcgtatttggtcagttggaacccggacctgatcgcggccgtcaaagattatatcgcctct
cacgtcaaccccgcagaccgcctaggccaaatcgagtatattttggtggcgaatgcgaac
gaagccgttcagaccgccaaccgcatagcccccgaacatctagggcttatcggggcggag
gtagagcccctctggcctcaactgaccacggcgggtgccctctttgtgggtcgactggcc
gggcaagccttgggcgattatgtcgccggcccgagccacgtattgccgaccggtcacacc
ggccgcttcttgtccgggctttcgacccgtacatttatgcgccgaatcagtgtcattcaa
accgaggatgctttaccggccgcgtttttggaagccggacaggtattggcccacttggaa
ggcttgcggtatcacgaacaatcgttagccgtccgacaacaattacgcggtcaggagggg
ctctaa

DBGET integrated database retrieval system