KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2734Help
Entry
Sulac_2734        CDS       T01746                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sulac_2734
  Amino acid metabolism
   00340 Histidine metabolism
    Sulac_2734
Enzymes [BR:sap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Sulac_2734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2691382..2692587
Genome map
AA seq 401 aa AA seqDB search
MSDPLIGDILDAVRDRGVKAVLEYTEAFDHVRLSPDDLIWNPLAEAPAVIDPAVREAVDF
AMDQIRRFHEATRPAPVTVNQAPGLILREVFQPLGRVGLYVPNGQFPLVSSLMMTAIPAQ
VAGVTDLVVAIAPRGHVTSDPVWLYVLQKLGIRQVLRVGGAQAIAALGYGLPGLPPVDLI
AGPGNRYVAWAKQELFRRGVTGIDVIAGPSEVLVISQDTAFAPLVALDLLAQAEHDPDAK
AYLVSWNPDLIAAVKDYIASHVNPADRLGQIEYILVANANEAVQTANRIAPEHLGLIGAE
VEPLWPQLTTAGALFVGRLAGQALGDYVAGPSHVLPTGHTGRFLSGLSTRTFMRRISVIQ
TEDALPAAFLEAGQVLAHLEGLRYHEQSLAVRQQLRGQEGL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccgttaatcggagacattttggacgccgtccgcgatcgcggggtcaaagcc
gtcttagagtacacggaagcctttgatcacgttcggttgtcgcccgacgatttgatttgg
aaccctctcgcagaagccccggccgtcattgatccggccgtccgggaagccgtcgatttt
gccatggatcaaattcgtcgctttcacgaggcaacccgaccggccccggtgaccgtcaac
caagctcccgggctcattctccgcgaggtcttccagcccttaggacgggtgggactttat
gtacccaacggccaatttcctttggtgtccagtttaatgatgaccgccatcccggcccaa
gtcgcgggggtcacggatctggtcgtggccattgccccccggggtcatgtcacgtcggat
ccggtctggctctatgtcctgcagaaactgggcattcgccaagtgttgcgggtgggcggg
gcgcaagccatcgccgcgctcggttacggattgccgggattaccgccggtggacttaatc
gccggtcccgggaaccgctatgtcgcgtgggccaaacaagaactctttcgccgcggggtg
accggcatcgacgtcattgcaggtccgtcggaagtcttggtgataagccaagatacggct
ttcgcacctttggtcgccttggatttgttggctcaggcggaacacgaccccgacgcgaaa
gcgtatttggtcagttggaacccggacctgatcgcggccgtcaaagattatatcgcctct
cacgtcaaccccgcagaccgcctaggccaaatcgagtatattttggtggcgaatgcgaac
gaagccgttcagaccgccaaccgcatagcccccgaacatctagggcttatcggggcggag
gtagagcccctctggcctcaactgaccacggcgggtgccctctttgtgggtcgactggcc
gggcaagccttgggcgattatgtcgccggcccgagccacgtattgccgaccggtcacacc
ggccgcttcttgtccgggctttcgacccgtacatttatgcgccgaatcagtgtcattcaa
accgaggatgctttaccggccgcgtttttggaagccggacaggtattggcccacttggaa
ggcttgcggtatcacgaacaatcgttagccgtccgacaacaattacgcggtcaggagggg
ctctaa

DBGET integrated database retrieval system