KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2809Help
Entry
Sulac_2809        CDS       T01746                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sulac_2809
Enzymes [BR:sap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sulac_2809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2779184..2780089)
Genome map
AA seq 301 aa AA seqDB search
MVLGSINLDLIAKVAQVPRPGETALAESLSMSPGGKGANQALAARRMGAETVMLGMVGED
AFAMQALKFLRQDGVDLSHIGVTREASTGLALISVEASGQNAITVAPGANAAIGADVLEA
LAHLLKPKDWLLLQCEIPLDVVERAIRIAKGVKARVMLDPAPAEARLPRSFFQVDVMTPN
QIEAETLIGHPVTDVRSAKAAARQLRSRGVEVAVVKLGDQGVVWATGHGLFYLPGEPVAA
IDAVGAGDAFQGALAARLAAGDGLAEAIRWANHAAALSTTRHGAQPSYPYWEEVWNTFSP
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggtattaggcagtattaatctggatttaattgcaaaagtcgcccaagtgccgcggccc
ggcgaaacggcgctggccgagagcctatcgatgagcccaggcggcaaaggcgctaatcag
gctcttgccgcccgcaggatgggtgcggaaaccgtcatgttggggatggtgggggaagac
gcgtttgccatgcaggcgttgaagtttctccggcaagatggggtcgatttatcgcatatc
ggggtaacgcgcgaggcttccaccggattagccttaatttccgtcgaagcgtccgggcaa
aatgccattacggtggctcccggtgccaatgcggcgattggggcggatgtgttggaggca
ttggcgcatctgttaaaacccaaggattggctattgctccagtgtgaaatccccttggat
gtggtggaacgcgcgattcgcattgcgaagggcgtcaaggctcgtgtgatgctggatccg
gctccggccgaagctcggttgccacgctcattctttcaggtggacgtcatgacgcccaat
cagattgaagccgaaaccttgataggccatccggtgaccgatgtccgcagtgccaaagca
gccgctcgacaactgcgtagccgcggcgtggaggttgccgtggtgaaattaggcgaccaa
ggggtggtgtgggccaccggtcatggccttttttacttgccgggtgagccggttgcggct
attgacgcggtcggtgccggagatgcctttcaaggggcgttggccgctcgcctggcagcg
ggggacggactggccgaagcgataagatgggccaatcacgccgcagccttatcgacgact
cggcatggcgcgcaaccttcatatccttattgggaagaggtttggaatactttttcgccg
gcatag

DBGET integrated database retrieval system