KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2909Help
Entry
Sulac_2909        CDS       T01746                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sulac_2909
Enzymes [BR:sap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sulac_2909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2871963..2872616
Genome map
AA seq 217 aa AA seqDB search
MQTSEPPRNIINASDLDAWEESVDPQSTGPIDTVKIQTAVRMILEAIGENPDREGLVETP
ARVARMYQEIFQGLYQNPHDVLATRFHVKQADLVLVKDIPFYSACEHHLLPFFGVAHIAY
LPEAGEVTGLSKLARLVDIFAKRPQVQERMTEDIAQALNDELGAQGVVVMVEAEHLCMAM
RGVKKPGSRTLTIAARGLYETEEAKRREVIDLMRRSL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacatccgaacctccgcggaatattatcaacgccagtgatttagacgcctgggaa
gaatccgttgatccccagagcaccggccccatcgacacggtcaaaattcaaaccgcggtc
cgtatgattttggaagccataggggaaaaccccgaccgggaaggactggtggaaaccccc
gcccgcgtcgcacggatgtatcaagaaatttttcaggggctctatcaaaatccgcatgac
gtgttggcgacccgttttcatgtcaagcaggcggatcttgtactcgtgaaggacatccct
ttttattcggcgtgtgagcaccatttgttgccctttttcggggtagctcacatcgcgtac
ctgccggaggcgggagaagtcaccgggttatccaaactggcgcggttggtggacattttt
gccaaaaggccccaagtgcaagagcggatgaccgaagatatcgcccaagccttaaatgac
gaattgggcgcgcaaggagtcgtcgtgatggtggaagccgagcacctctgcatggccatg
cgcggcgttaaaaagccgggcagccgaactcttacgattgccgcccggggcctctatgaa
accgaagaagccaagcgccgcgaggtcattgacctgatgcgccgttcgttatga

DBGET integrated database retrieval system