KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2946Help
Entry
Sulac_2946        CDS       T01746                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sap01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sap00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sap00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sap00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:sap00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2908393..2910414)
Genome map
AA seq 673 aa AA seqDB search
MSDEHMTSSDIEVHWREEEYINSPASFVAQANLTDPTIYERFNLDNFPHYFTEYAELLDW
YQKWDRVLDDSNPPFWRWFTGGQINAAYNCVDRHLPALQSKVAYYFVSEREDDPVQSLTY
RELYWRVNEFAAILRDFAGVQKGDRVTIHMPMVPELPIAMLACARLGAMHSVVFGGFSGQ
ACADRIIDSQSRILVTMDGYYRNGKWLDHKEKADVAVARAAEVGQPVDKVLIFERHWGQY
GGSPLVEGRDFLVSQLAPRYRGQVVEPEPMPGEAPLFLMYTSGSTGKPKGIQHGTAGYLS
YAAATSKYVLDIQPDDVYWCMADIGWITGHSYIVYGPLALGATSVLYEGGPTYPDAGRPW
RIAERLGVTIFHTSPTAIRSLRQFGEEIPQKYHYRFKLMATVGEPIEPDVWRWYFHVIGR
GQAAVVDTWWQTETGGHLCSTIPAIKPMKPGSAGPGLPGIHPVVLDETGQEVAPGSGEGG
YLCIRNPWPGIMQTIWGDPERYVRTYYGKYNKNPESKDWRDWPYMAGDGAMMAADGYLRI
LGRIDDVINVAGHRLGTKELESAVLTLDEVAEAAVVAAHDEIKGAMPEIYVSLHPGVEAT
PQLTQKIVDVIVRDIGPIARPRHVWVVPDLPKTRSGKIMRRILAAISDNREIGDVTTLAN
PEVVETIQKMARP
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgaacatatgacatcttccgacattgaggtacattggcgcgaagaagagtat
ataaattctcccgcgtcttttgtagcgcaagccaacctcacggaccctacgatttatgag
cgttttaacctggacaactttcctcactatttcacggaatatgccgaacttttggactgg
tatcagaaatgggaccgggtgttagacgactccaaccccccgttttggcgctggtttacc
ggcgggcaaattaatgccgcgtataactgtgtcgaccgccacttacccgcattacagagt
aaagtggcctactatttcgtttccgagcgggaagacgatcccgttcaatcgttgacctat
cgtgaactgtactggcgggtcaacgagtttgccgcgattttacgggattttgccggggtt
caaaagggcgatcgagtgaccattcatatgcccatggtgccggaactcccgattgctatg
ttggcgtgtgcccgtctcggggctatgcattcggtggtgttcggcggatttagcggacag
gcttgtgccgaccggatcatcgattctcaaagccgcattttggtcaccatggacgggtat
taccggaacggaaaatggcttgaccacaaagaaaaagccgatgtggcggtggcccgggcg
gccgaggtcggccaaccggtggacaaagtgttgatttttgagcgccattggggccaatat
gggggatcgccgttagtggaggggcgcgattttctggtgagccaactcgccccccggtat
cgcgggcaggtggtcgaaccggagccgatgccgggtgaggcgcccctctttttgatgtat
acgagcggttccaccggcaaaccgaaagggattcagcatggcaccgcgggttatttgtct
tacgccgccgcgacctccaaatacgtgttggacattcagccggatgacgtctattggtgt
atggcggatatcgggtggattaccggccattcctatattgtctatggtcccttggcgcta
ggggctacctcggtgctctacgagggcggacccacttatcccgatgccgggcgcccctgg
cggattgccgaacgattgggcgtcaccattttccacacgtcgccgacggctatccgcagc
ctccgtcagtttggcgaggaaatcccgcaaaagtatcattatcggttcaagttgatggcg
acggttggtgagccgattgaaccggacgtctggcgttggtatttccatgtcattggccgg
ggacaggcggccgtggttgacacctggtggcagactgaaaccggtgggcacctctgcagt
accatcccggccataaagcccatgaaacccggtagcgcgggtcctggactacccggtatc
cacccggtggtgctggatgaaaccggccaggaagtggcgccggggtccggcgaaggcggt
tatctctgcattcgaaacccttggccgggtatcatgcaaacgatttggggcgatcccgaa
cgttatgtccgcacctattacgggaagtacaacaagaaccctgaaagcaaagactggcgt
gattggccgtacatggcgggcgacggggcgatgatggcggcggatggatatctccgcatc
ttgggccggatcgatgacgtcattaatgtggcaggtcatcgcttagggaccaaagagctt
gagtccgcggtgctgacgttggatgaggtggcggaggcggcagtggtcgctgcgcatgac
gagatcaaaggcgctatgccggagatctatgtatcgctgcatcccggcgtggaagcgacc
ccccaactgacgcaaaagattgtcgacgtcattgtccgcgatattgggccgattgcccgc
ccgcgtcacgtctgggtggttccggatttacccaagacgcgatccgggaagattatgcgc
cggatcttggcggcgatctccgataatcgagagattggggacgtcaccaccttagccaat
ccggaagtggtggaaaccattcaaaagatggcgcgtccttaa

DBGET integrated database retrieval system