KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_2998Help
Entry
Sulac_2998        CDS       T01746                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sulac_2998
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sulac_2998
   00650 Butanoate metabolism
    Sulac_2998
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Sulac_2998
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sulac_2998
   00622 Xylene degradation
    Sulac_2998
   00621 Dioxin degradation
    Sulac_2998
Enzymes [BR:sap01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sulac_2998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2959414..2960313)
Genome map
AA seq 299 aa AA seqDB search
MAKLTAAIIGSGNIGTDLLYKLRRSDWIEPRWMVGIDPQSEGLARARAMGLETTHEGLKA
LLNSGVRPDLAFDATSARAHVRHAKMLRDLGIQAIDLTPAARGPYVIAAVNLGDHLDAPN
VNMVTCGGQATTPMVYAVSRVTRVSYAEIVATIASKSAGPGTRQNIDEFTETTAKALEVI
GGAAEGKAIIILNPADPPIYMRDTIYCDIPDATAEDQERIIASIRDMVRHVQQFVPGYHL
NRDPIFRDGMVSISIEVEGLGDFLPKYSGNLDIMTAAATRVGEAIAQHRLAHATGGMIQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattaacggcggcgatcatcggatccggcaatatcgggacggatttattatac
aaactgcgccgtagcgactggattgaaccccggtggatggtcgggatcgatccccaatcg
gaagggttggcgcgggctcgggccatgggcctggagacgacccacgaggggttaaaagcg
ttattgaatagtggggttcggcccgatttggcatttgacgccaccagtgctcgcgcccat
gtgcgccacgcgaaaatgttgcgggatttggggattcaagccattgacttgactccggcg
gcccggggcccttatgtcatcgcggcggtcaatttaggagaccatctcgatgcgccgaat
gtcaatatggtcacgtgtggcgggcaagccaccacgccgatggtctatgccgtcagtcgg
gtcacccgggtgagttatgccgaaatcgtcgcgacgattgccagtaagagtgccggccca
ggtacccgacagaacatcgacgaatttaccgagacgaccgccaaggccctggaagtgatt
ggcggggcggccgagggtaaggccatcattatcttgaatccggccgatccgccgatttac
atgcgggataccatttattgcgacattccggatgcgaccgccgaggaccaggaacggatt
atcgcgtccatccgggacatggtccggcacgtgcaacagtttgtcccgggctaccacctg
aatcgggaccccattttccgcgacggtatggtcagtatttccattgaagtggaagggctc
ggggattttctgcccaaatattccggaaatctcgacatcatgacggcggcggcgacacgc
gtgggcgaagcgattgcccaacatcggttggcacatgccacgggagggatgattcaatga

DBGET integrated database retrieval system