KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_3062Help
Entry
Sulac_3062        CDS       T01746                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sap00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sap00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3019293..3020750
Genome map
AA seq 485 aa AA seqDB search
MATLLSLLEGLPGFDRSVLTDLPIRSIVLDSRQATVQSLFVALPGQHQHGADFAADAVRR
GAVAVISSASRPSGWPPVIPWIQTDNPRMWLPTLAARLYQFPARRLTLYGVTGTNGKTTT
VYMLAAILRRAGRRVAFWSTNQVEGIPHPYRPAMTTPDSPALHEFLRQAVDTGAEDVLLE
VSSHALALNRIGGLRFAAVAVTNITPDHLDFHGSFADYVAAKASIVQYVKPGGAVILNGD
DPVISGWQTPAVVTRTTYGFSGTHPLTARIIESHADHSRWEWFWQNQSYGEIVLPVPGRH
NIQNALAALGMALHCGIAPDVARDALAHFVPAPRRLETVTQGDITVVSDVAMNRASYEAV
LATVHSLGRPVVVVNAIRGNRGPDINRDIVDVLADWADHMAFAPVIATLSTDQVASLSVD
YRVRPDEQAAFLEQANRRGLAVICTDTLEAAIDAALARLPKGGILLLLGTFGMDAGLALV
RDRIG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctgctttctttgttggaaggtctaccgggctttgaccggtccgtcctaacc
gatctccctatccggtccattgtcctcgattctcgccaagctacggttcagagtctcttt
gtggctctcccgggccaacatcaacacggcgccgactttgcggcggatgccgttcggcga
ggagcggtggccgtcatctcgagtgcatcgcgcccttccggttggccaccggtaattccc
tggattcagacggataatccccgaatgtggctaccgactctagcggcccgcctgtaccaa
tttcccgcccgccgtctcaccctctatggggtcaccgggaccaacgggaaaaccacgacc
gtttacatgctggccgcgatattacggcgtgccggccgccgggtcgccttttggagcacc
aatcaggtcgaaggcatcccccatccttaccgtcccgccatgaccactcccgattcgccg
gccttgcacgaatttttgcggcaagcggtagataccggggcagaagacgtcttgttggaa
gtctcgtcgcacgcgttggcgcttaaccgcatcggcggactgcggtttgccgccgtcgcc
gtgaccaatattacgcccgatcatttggattttcatggttcgttcgcagactatgtggcg
gccaaggcatccattgtgcaatatgtcaaacccggtggcgcggtgatattaaacggggat
gatccggtgatttccggctggcaaacgccggccgtggtcacgcgaaccacctacgggttt
tccgggactcaccccttaaccgcccggatcatcgaatcgcatgcggatcacagccgatgg
gaatggttttggcaaaaccaatcctatggtgaaatcgtccttccggtccccggacgccat
aatatccaaaatgccctcgccgccttgggcatggcccttcattgcgggatcgcaccggac
gtcgctcgtgatgcgttagcgcatttcgtacccgctccccgccggctcgaaacggtgacc
caaggcgacattaccgtggtcagcgatgtggcgatgaaccgggctagttatgaggccgtc
ttggcgaccgtccattctctcgggcgccccgtcgtcgtggtcaacgccattcgcggtaat
cgcggtccggatatcaatcgcgacattgtcgacgtgctggcggactgggccgatcacatg
gcctttgccccggtcattgcgaccctgagtaccgatcaggtcgcatccttatccgtcgac
tatcgcgtgcgcccggacgaacaagcggcatttttagagcaagccaaccggcgcggattg
gccgtgatctgtaccgatacgttagaggcggccatcgatgccgccctggcccggctgccg
aagggcggcatcctcttattgctgggtacctttggcatggacgccggtctggccctggtc
cgggatcggatcggttag

DBGET integrated database retrieval system