KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_3235Help
Entry
Sulac_3235        CDS       T01746                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sap00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sulac_3235
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sulac_3235
Enzymes [BR:sap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sulac_3235
Two-component system [BR:sap02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Sulac_3235
Bacterial motility proteins [BR:sap02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sulac_3235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3179805..3180866)
Genome map
AA seq 353 aa AA seqDB search
MLTGMNEAEDRGVRVVVVDDSAFFRYELGSRLVRRGWQLVASVASGEEALKVVPLLQPDL
VMMDVVMPGMGGMAAVRALRRRWPGLILMMSGQSDTGTAATWDALEAGANDFIPKPHADQ
TLDAMVRQIVDRYRALAPRGSEGPQPEKGTTFDKEPRTEGFKAIVIGASTGGPQALSFLL
ETIRLAPRIPVLIVQHMPSGFTRSFAERLADRLGYPVQESPPEGDMVPWDPPPVIVAAGG
KHLRVSRQGAWSESGERLHGVIPSVDVTLSDAVSVFGRDLGVVILTGMGEDGAQGALAVH
QRGGTVIAESRETALVWGMPRAVFEAGAADAVWPLGRISLWLRQVIQHGVPLR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgggtatgaatgaggcagaggatcgcggagtgcgggtcgtcgtggtcgacgac
tccgccttttttcgctatgaattgggatcccggttggtgcgccgagggtggcagttggtg
gccagcgtggcctccggagaagaagcgttaaaagtagtcccgcttcttcagccggatttg
gtaatgatggatgtcgtcatgccgggcatgggggggatggcggcggtccgggctttaagg
cggcggtggcccggattgattcttatgatgtcgggccaaagcgataccggcacggcggcc
acctgggatgcgctggaggctggggctaacgactttattccgaagccgcatgcggatcaa
acattggatgcaatggttcgtcaaattgtcgaccggtatcgggctttggcgccgcggggg
tctgagggtccgcagcccgagaaaggcaccaccttcgacaaggaaccacggaccgaagga
ttcaaagcgatcgtcatcggggcttcgaccggcgggccgcaagcgttgtcgtttttgttg
gaaactattcggttggctccccgcattccggtactcattgtacaacacatgccctccggc
tttacccgttcgttcgccgaacggttggctgatcggttgggatacccggttcaagagtcg
cctccggaaggggacatggtgccttgggatccgcctccggtgattgtggcggcgggcggc
aaacatctgcgcgtcagccgtcagggcgcttggagcgagtcgggcgaacggctgcatggg
gtcattccgtcggtcgacgtcaccctgagcgatgcggtttccgtgtttggccgcgacttg
ggcgtggtcattttgaccggcatgggagaagacggggctcaaggggctttagccgtgcat
cagcggggagggaccgtcattgccgaatcgcgggaaaccgctttggtgtggggcatgccg
cgggcggtttttgaggccggcgcagccgatgcggtgtggccgcttgggcgcatcagttta
tggttaagacaggtgattcaacatggggtaccgctacgatga

DBGET integrated database retrieval system