KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_3294Help
Entry
Sulac_3294        CDS       T01746                                 

Definition
(GenBank) acireductone dioxygenase apoprotein
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00270  Cysteine and methionine metabolism
sap01100  Metabolic pathways
Module
sap_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Sulac_3294
Enzymes [BR:sap01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Sulac_3294
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Sulac_3294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 Cupin_3
Motif
Other DBs
NCBI-ProteinID: AEW06740
UniProt: G8TT40
Position
3243624..3244151
Genome map
AA seq 175 aa AA seqDB search
MAKVYDRTNQKEVPESELIPYLAAHGIHYEYWPIDRLPDSLRTQKTLSAEEQSQVIAAFA
PELQRMSRDYGYISHDVVVLNTVSTPNLDELLANFERFHRHSEDEVRFIVDGAGVFTLER
EGDLFDVTVYAGDLISVPRGTRHYFTLTETRNVKAIRLFQTREGWVAIYDEEAVS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagtttacgatcgcacgaaccaaaaagaggtaccggaatctgaattaattcct
tatctagccgcccacggtattcattatgaatattggccgattgatcggctgccggattca
ttgcggacccagaaaaccttatcggccgaagagcaatcccaagtgatcgcggcattcgcc
ccggaactccaacgcatgagtcgggattacggctatatctcccacgacgtggtggtattg
aacaccgtcagtacccccaatctcgatgagctgttggccaattttgagcggtttcatcgg
cacagcgaagatgaagtgcgctttatcgtcgatggagccggtgtctttacccttgaacgg
gaaggggatctattcgatgtcacggtctatgccggtgatttgatttctgtcccccgaggc
actcgccattactttaccttaaccgagacccgaaacgtgaaagccattcgcctgtttcaa
acgcgggaaggttgggtggccatctacgacgaggaggctgtctcatga

DBGET integrated database retrieval system