KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_3294Help
Entry
Sulac_3294        CDS       T01746                                 

Definition
acireductone dioxygenase apoprotein (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sap00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3243624..3244151
Genome map
AA seq 175 aa AA seqDB search
MAKVYDRTNQKEVPESELIPYLAAHGIHYEYWPIDRLPDSLRTQKTLSAEEQSQVIAAFA
PELQRMSRDYGYISHDVVVLNTVSTPNLDELLANFERFHRHSEDEVRFIVDGAGVFTLER
EGDLFDVTVYAGDLISVPRGTRHYFTLTETRNVKAIRLFQTREGWVAIYDEEAVS
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagtttacgatcgcacgaaccaaaaagaggtaccggaatctgaattaattcct
tatctagccgcccacggtattcattatgaatattggccgattgatcggctgccggattca
ttgcggacccagaaaaccttatcggccgaagagcaatcccaagtgatcgcggcattcgcc
ccggaactccaacgcatgagtcgggattacggctatatctcccacgacgtggtggtattg
aacaccgtcagtacccccaatctcgatgagctgttggccaattttgagcggtttcatcgg
cacagcgaagatgaagtgcgctttatcgtcgatggagccggtgtctttacccttgaacgg
gaaggggatctattcgatgtcacggtctatgccggtgatttgatttctgtcccccgaggc
actcgccattactttaccttaaccgagacccgaaacgtgaaagccattcgcctgtttcaa
acgcgggaaggttgggtggccatctacgacgaggaggctgtctcatga

DBGET integrated database retrieval system