KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_3310Help
Entry
Sulac_3310        CDS       T01746                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
sap00071  Fatty acid degradation
sap00280  Valine, leucine and isoleucine degradation
sap00281  Geraniol degradation
sap00310  Lysine degradation
sap00360  Phenylalanine metabolism
sap00362  Benzoate degradation
sap00380  Tryptophan metabolism
sap00410  beta-Alanine metabolism
sap00627  Aminobenzoate degradation
sap00640  Propanoate metabolism
sap00650  Butanoate metabolism
sap00903  Limonene and pinene degradation
sap01100  Metabolic pathways
sap01110  Biosynthesis of secondary metabolites
sap01120  Microbial metabolism in diverse environments
sap01130  Biosynthesis of antibiotics
sap01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sulac_3310
   00650 Butanoate metabolism
    Sulac_3310
  Lipid metabolism
   00071 Fatty acid degradation
    Sulac_3310
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sulac_3310
   00310 Lysine degradation
    Sulac_3310
   00360 Phenylalanine metabolism
    Sulac_3310
   00380 Tryptophan metabolism
    Sulac_3310
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sulac_3310
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sulac_3310
   00281 Geraniol degradation
    Sulac_3310
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sulac_3310
   00627 Aminobenzoate degradation
    Sulac_3310
   00930 Caprolactam degradation
    Sulac_3310
Enzymes [BR:sap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sulac_3310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEW06756
UniProt: G8TT56
Position
complement(3267160..3267960)
Genome map
AA seq 266 aa AA seqDB search
MENVLDYQQEGPIVTIWLNRPEVHNAVNDALAEALRVAWTRFRDDETALVAILAGRGPSF
SSGADLTQLESLNRPDTYLNADFIYRGTGYLGFTRMTDVFKPTIAAIHGYCVAGGLEMAL
WCDIRLATANARFGCLERRWNVPLVDGGTQRLPRTIGWGRAMDLMLTGREIDAETALAWG
LVSAVTTEDTAYPMARKWARKIADYPQGALRTDKQAAMRGWGLPLEEALRTEAMLGMTQL
NSSELTEGLQRFRTRQGKGAESDATD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atcgaaaacgtattagactatcaacaagagggcccgattgtcaccatttggctgaaccga
ccggaggttcacaatgcggtcaatgatgcgttggcggaagcgcttcgcgtcgcctggacc
cgctttcgtgacgacgaaacggccctcgtagccatcttggcgggacgcgggccttctttt
tcgtcgggggcggacctcacgcagcttgagagtttaaatcggccggatacctacctaaat
gcggattttatctatcggggcacggggtatctcgggtttacccgaatgaccgacgtattt
aaacccacaatagccgccattcacggctactgcgtcgccgggggactggaaatggccctt
tggtgcgatattcgcctcgcgacggccaatgcccgcttcggctgtctcgagcgtcgctgg
aacgtaccgttagtcgacgggggcactcaacgcctaccccggactataggctgggggcgg
gccatggacttaatgctgacgggacgggaaatcgatgcggaaaccgctttggcctggggg
ttagtcagtgccgtgacgaccgaagacacggcgtatccaatggcccggaagtgggcccga
aagattgcggattacccgcaaggggctttgaggaccgacaagcaagcggcgatgagagga
tggggtttacccttggaagaggcgttacggaccgaagccatgctaggcatgacccaacta
aattcctccgagttaacggagggattgcagcgttttcgaactcgtcagggaaagggagct
gagagtgatgccacggattga

DBGET integrated database retrieval system