KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_3347Help
Entry
Sulac_3347        CDS       T01746                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sulac_3347
   01230 Biosynthesis of amino acids
    Sulac_3347
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sulac_3347
   00030 Pentose phosphate pathway
    Sulac_3347
   00051 Fructose and mannose metabolism
    Sulac_3347
   00052 Galactose metabolism
    Sulac_3347
  Energy metabolism
   00680 Methane metabolism
    Sulac_3347
Enzymes [BR:sap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sulac_3347
Protein phosphatases and associated proteins [BR:sap01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sulac_3347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3310436..3311392)
Genome map
AA seq 318 aa AA seqDB search
MRYGVLTSGGDAPGMNAAIRSVVRSGLAKGHEVFGVERGYEGLVKGWGHMLDRSSVADIL
MAGGTMLHTARFPGFRDEAVRRQAMEQIGAWHLDGLIVIGGNGSLAGAGALSAAGIPVVG
IPASIDNDIAGTDWSLGFDTAVNNVVQSVDKIRDTASAHERVFVVEVMGNRTGILAAVAG
LAAGAEAVIIPERPVDLNELADRLTETQRRGKKHSFIIVAEGADHADRVARGIQERTQFD
VRWVVLGHTQRGGPASATDRILGALYGNKAVDALDAGQYGVMIGQVQGNLTLTPLATVLA
ESPRVPMDWVDLAELLAR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgcggtatggtgtgctaacgtcgggcggtgatgcgccggggatgaatgcggctatccgt
tcggtcgtgcgtagcggtttggctaaagggcatgaagtgtttggggttgaacgcggttat
gagggattggtcaaaggttggggacatatgctcgaccgatcgtcggtggccgatattctc
atggccggaggaacgatgttacatacggcccggtttcccggatttcgggacgaagcggtt
cggcgtcaagcgatggagcaaataggagcttggcacttggacgggctcattgtcatcggc
ggcaacggatcgttggccggtgccggagccttgtcggcggcaggtattcctgtggtcggg
attcccgccagtatcgataacgacattgccgggaccgattggagtctaggattcgacacc
gcggtgaataacgtggtccaatctgtcgacaaaattcgcgatacggcttcggcccatgag
cgggtgttcgtagtcgaggtgatgggtaaccgtaccggaattttggccgcggtcgcggga
ttggcggcgggcgccgaagcggtgattattcccgagcggccggttgacctgaacgagctg
gccgatcgactgacggaaacgcaacggcgcggtaaaaaacacagtttcattatcgtggcg
gaaggtgctgatcacgccgatcgagtggctcgcggcattcaagaacggacgcaattcgat
gtccgctgggtcgtgctgggtcatacccagcgagggggaccggccagtgcgaccgatcgt
attttaggcgccttatatggcaacaaagcggttgacgccttagacgccggccaatacggg
gtgatgatcggccaagtgcaggggaacttgacgctgacgccgcttgccaccgtattggcg
gaaagtccccgggtaccgatggactgggtcgatttagcggagctgcttgcacggtag

DBGET integrated database retrieval system