KEGG   Sulfobacillus acidophilus DSM 10332: Sulac_3501Help
Entry
Sulac_3501        CDS       T01746                                 

Definition
L-fuculose 1-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sap  Sulfobacillus acidophilus DSM 10332
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sap00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3455616..3456251)
Genome map
AA seq 211 aa AA seqDB search
MDALMAVIDQIQADRITFAASGNVSVRDPRHPDRFWITPSGVAWPHITYDDLVALSVETG
TVLDGRLKPSTEWRFHRTLYARHDWIGGVVHLHSRYATIFSTLGEPIKPVHYQMARVAYQ
VPVVPYETYGTPALAEAVGTVIDKDCQAALLANHGLVAVGDTVAKAYQYAQEIEWMADIY
YHARLLGTPRILTVEEIEKVRDQFAQYGQTP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgttaatggccgtcatcgaccaaattcaagcggatcggatcacgttcgccgcc
tccggcaacgtcagtgtccgagacccgcgacatccggatcgtttttggattaccccgtcg
ggtgtggcttggccccacattacgtatgacgatttggtcgccctgtcggtcgagaccggg
acggtgcttgatggccggttaaagccctccaccgaatggcggtttcaccggacgctctat
gcacggcacgactggataggtggggtggtccacctccattcccgctacgcgacgattttt
tcgacactgggagaaccgataaaaccggttcactatcaaatggcccgtgtggcttaccag
gtgcccgtggtaccctacgaaacctatggcacgccggccttggccgaagccgtgggaacc
gtgattgataaagattgccaagcggctctgttggccaatcatggactcgtcgccgtcggc
gacacggtcgccaaggcctatcaatatgcccaggaaatcgagtggatggccgatatctat
tatcatgcccgtcttctgggcacgccccgcattttaaccgtcgaggaaattgaaaaggtt
cgcgaccaatttgcccaatacggtcaaaccccttga

DBGET integrated database retrieval system