KEGG   Salinispora arenicola: Sare_0159Help
Entry
Sare_0159         CDS       T00613                                 

Definition
phosphoribosylformylglycinamidine synthase II (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
saq  Salinispora arenicola
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:saq00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
169876..172425
Genome map
AA seq 849 aa AA seqDB search
MTTQDPVRDSDAAVAGPTAAPDRDATVIGWVGGVDTVPHAGDSPDELQPYAELGLRDDEY
ARIRQLLNRRPTQAELAMYSIMWSEHCSYKSSKVHLRQFGEKAPSSDRMLAGIGENAGVV
RVSDELAVTFKVESHNHPSFVEPHQGAATGVGGIVRDILAMGARPVAVMDPLRFGAADHP
DTARVLPGVVAGIGGYGNCLGLPNIGGEVVFDPCYQGNPLVNALCVGVLPVDRLQNKAAA
GTGNVVVLMGAKTGRDGIGGVSVLASATFDEGSEQRRPSVQVGDPFIEKLLIEACLELYD
EQLVVGIQDLGGAGLTCALAETAAAAGTGMRVWLERVPLREPSMEPHEILASESQERMLL
VVEPEKLEAVLQTAEKWGVLATAIGEVTAPAPDGQPGRLVITWRDHLVVDVPPGSLADDG
PVYHRPMREPADLILLQADRAETLPRPSDPDSLRETVLRMIASPNLADKTWVTEQYDRYV
LGNTVLAQPEDSGVIRIDERSGIGIALSVDGNGRYARLDPYHGAKLALAEAYRNVAVTGA
KPIAVTDCLNFGSPEDPGVMWQFAEAVRGIADGCGELGIPVTGGNVSFYNQTGAAAIHPT
PVVGVLGVLDDVADRIPMGFVPRDGGHDQIYLLGDTNVELSGSEWAWATHEHLGGVPPRV
DLDRERAIADLMAVAARGGHLSSAHDLSDGGLAQSLVESCLRRGVGARVTLPEQFTGGSM
PFVFLFSESAGRVLVSVPRGHEKAFTALAAEHGVPCELIGVTDTAGGALELHGQFRLGLD
ELRAAHSATLPRLFGGAELGAANASAVGDAGSPAGAVATPPVTMTEEPTATGGPAAPIDT
EPPPGADER
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccaggacccggtccgggactcggacgccgctgtggccggaccaacggccgcc
cctgaccgggacgccaccgtcatcggctgggtcggcggcgtggacaccgtcccccatgcc
ggcgacagcccggacgagcttcagccctacgccgaactgggcctccgtgacgacgagtac
gcccggatccggcagctgctcaaccgtcgacccacccaggccgagttggccatgtactcg
atcatgtggagcgagcactgctcctacaagtcgagcaaggtgcacctgaggcagttcggg
gagaaggcgccgtccagcgaccggatgctcgccggcatcggtgagaatgcgggcgtggtt
cgggtctccgacgagctcgcggtcaccttcaaggtcgagtcgcacaaccacccgagcttc
gtcgagccccaccagggcgcggccaccggcgtcggcggcatcgtccgggacatcctcgcc
atgggcgcccgcccggtcgcggtgatggacccgttgcgcttcggcgcggccgaccacccg
gacaccgcccgcgtgctgccgggcgtggtcgccgggatcggcggctacggcaactgcctc
ggcctgccgaacatcggtggcgaggtcgtctttgacccctgctaccagggcaacccgctg
gtcaacgcactctgcgtcggcgtgctgccggtcgaccggcttcagaacaaggccgccgcc
gggaccggaaatgtcgtggtgctgatgggcgccaagaccggccgcgatggtatcggcggt
gtgtcggtgctggccagcgccacctttgacgagggcagtgagcagcgccgtccctcggtg
caggtgggtgacccgttcatcgagaagctactcatcgaggcgtgcctggagctctatgac
gagcagctcgtcgtcggaatccaggacctcggtggcgccgggctgacgtgtgccctcgcc
gagacggccgccgcggcgggcaccggcatgcgggtctggctcgagcgggtaccgctgcgg
gagccttcgatggaaccgcacgagattctggccagcgagtcccaggaacggatgctgctg
gtcgtcgagccggagaagctggaggcggtgctccagaccgccgagaagtggggcgtgctg
gccaccgcgatcggcgaggtcaccgcaccggccccggacggccagccgggccgcctggtc
atcacctggcgggatcacctggtcgtcgacgtcccaccgggctcgttggccgacgacggg
ccggtctaccaccggccgatgcgtgagccggccgacctgatcctgctccaggccgaccgc
gcggagacgctaccccggccgagtgaccccgactccctgcgggagacggtcctacggatg
atcgcctcgccgaacctcgccgacaagacctgggtcaccgagcagtacgaccggtacgtg
ttggggaacaccgtgctcgctcagcccgaggactcgggtgtgatccggatcgacgagcgg
agcggtatcggcatcgcgctctccgtcgacggcaacggccggtacgcccgcctcgacccg
taccacggcgccaagctcgcgctggccgaggcgtaccggaacgtggccgtgaccggtgcc
aagccgatcgccgtcaccgactgcctcaacttcggttcgccagaggacccgggcgtgatg
tggcagttcgccgaggccgtccgtggcatcgccgacggctgcggcgaactgggcatcccg
gtgaccggcggtaacgtcagcttctacaaccagaccggcgcagcagccatccatccaacc
ccggtggtgggcgtcctcggcgtgctggacgacgtggccgaccggatcccgatgggcttc
gtcccgcgcgacggcggtcacgaccagatctacctgctgggtgacacgaacgtggagttg
tccggatcggagtgggcgtgggctacccacgaacacctcggcggcgtacctccccgggtg
gacctcgaccgggaacgggcgatcgccgacctgatggcggtggcggcccggggtgggcac
ctcagctccgcacacgacctctccgacggcggtctcgcgcagagcctggtcgagtcctgc
ctgcgccggggtgtcggtgcccgggtcactctgccggagcagttcaccggcggctcgatg
ccgttcgtcttcctgttcagcgaatccgccggccgggtgctggtctcggtgccgcgcggg
cacgagaaggcgttcaccgcactggctgccgagcatggcgtgccgtgcgagctgatcggc
gtcaccgacacggcgggtggggcgctggaactgcacggccagttccgtcttggcttggac
gagctgcgcgccgcccacagtgccaccctgccccgccttttcggcggcgcggaactcggg
gcggcgaatgcctcggcggtgggcgacgccggctcgccggctggtgcggtcgccacgccg
ccggtcacgatgaccgaggagccgaccgcgaccggtgggccagcggctcccatcgacacc
gagccgccacccggggcggacgagcgctga

DBGET integrated database retrieval system