KEGG   Salinispora arenicola: Sare_0254Help
Entry
Sare_0254         CDS       T00613                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
saq  Salinispora arenicola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:saq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sare_0254
DNA repair and recombination proteins [BR:saq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sare_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
281077..281670
Genome map
AA seq 197 aa AA seqDB search
MYEGAIQDLIDELGRLPGVGPKSAQRIAFHVLSADPADVNRLADVLRKVKELVRFCTSCY
NVAESEQCRICRDPRRTDEVLCVVEEPKDVVAIERTGEFRGRYHVLGGAINPLEGVGPDN
LRVRELLTRLGGGAVRELILATDPNTEGEATATYLALMVKPMGIAVSRLASGLPVGGDLE
YADEITLGRAFEGRRSV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagggcgccatccaggacctgattgacgagttgggtcggctgccgggtgttggc
ccgaagagcgctcagcggatcgcctttcacgtcctgtccgcggacccggccgacgtcaac
cggctggctgacgtgttgcgcaaggtcaaggagctggtgcgtttctgcaccagctgctac
aacgtggccgaatccgagcagtgccggatctgccgtgatccccgccgtaccgacgaggtg
ctctgcgtggttgaggagccgaaggatgtggtggcgatcgagcggaccggtgagttccgc
ggccgctaccacgtgctcggtggcgcgatcaacccgttggagggggtcgggccggacaat
ctgcgcgtccgggagttgctgacccggttgggtggtggcgcggtgcgggagttgattctg
gccaccgatccgaacaccgagggtgaggcgacggccacctatctggcgttgatggtgaag
ccgatgggtatcgcggtgtctcgtctggccagtggcctgccggtcggcggcgacctggag
tacgccgatgagatcactctcggtcgtgcgttcgaggggcgccggagcgtctga

DBGET integrated database retrieval system