KEGG   Salinispora arenicola: Sare_0269Help
Entry
Sare_0269         CDS       T00613                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
saq  Salinispora arenicola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:saq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sare_0269
Enzymes [BR:saq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sare_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(299357..301585)
Genome map
AA seq 742 aa AA seqDB search
MADVTAAPRPALATLEAVLERLTYVNEETGYTVARVATDGGGDLLTVVGALLGAQPGESL
RLHGRWSSHPKYGRQFEVDSYTTVLPATIQGIQRYLGSGLVKGIGPVFAERIVAHFGLDT
LRIIEEEPGRLVEVPGLGPKRTAKITAAWEEQQAIKEVMVFLQGVGVSTSLAVRIYKQYG
DTSTDVVTKEPYRLAADVWGIGFKTADTIAQAVGIPHDSPQRVMAGLQYTLSEATDNGHC
YLPEPELVTDATKILDVPADLVARCLDDLVADEGVVRDTLPGSDAESVRAVYLVPFHRAE
RSLASSLLRLLSDGNDRLPHFVGVDWAKALAWLRARTGNDLAPEQEQAVRLALTSKVAVL
TGGPGCGKSFTVRSIVELAAAKKAKVTLVAPTGRAAKRLSELTGHPAATVHRLLQLRPGG
DASYDRDNPLDVDLLVVDEASMLDLILANKLVKAVPPGAHLLLVGDVDQLPSVGAGEVLR
DLLAAPTVPRVRLTQIFRQAAQSGVVTNAHRINAGRPPLLQGLPDFFLFACDDTEAAAAR
TVDVACTRIPATFRLDPRRDVQVLTPMHRGPAGSGTLNTLLQQRLTPHQEGLPERRAGGR
VFRVGDKVTQIRNNYDKGQAGVFNGTLGIVTDLSAEEQTLTVRTDEDESIDYDFDELDEL
AHAYAMTIHRSQGSEYPAVVIPLTTSAWMMLQRNLLYTAVTRAKQLVVLVGSRRALSAAV
RTVGAGRRHTALNHRLDAATDR
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgtgactgctgcgccccgtcccgccctggcgacactcgaggcggtgttggag
cggctcacgtacgtcaacgaggagaccggctacaccgtcgcccgggtggccaccgacggc
ggtggtgacctgctgacggtggtgggcgctctgctgggcgcgcagccaggggagagcctg
cggctgcacggtcggtggtcctcgcaccccaagtacggtcgacagttcgaggtcgactcg
tacaccacggtcctacccgccacgatccagggcatccagcgctacctcggctcgggcctg
gtgaagggcatcggaccggtgttcgccgaacggatcgtcgcccacttcggcttggacacg
ctgcggatcatcgaggaggaaccgggccgcctggtggaggtccccgggctgggccccaaa
cgcaccgcgaagatcaccgcggcgtgggaggaacagcaggccatcaaggaggtcatggtc
tttcttcagggcgtcggcgtctcgacctccctcgcggtacggatctacaagcagtacggc
gacacctccaccgacgtggtcaccaaggagccgtaccggctggcggccgacgtgtggggc
atcggtttcaagaccgccgacaccatcgcccaggcggtcggcatcccccacgacagccca
cagcgggtcatggccggcctgcagtacacactctccgaggccactgacaacggccactgc
tacctgcccgagcccgagttggtcacggacgccacgaagatcctcgacgtgcccgccgat
ctcgtcgcccgctgtctcgacgacctggtcgccgacgagggggtcgttcgcgacacgctg
cccggcagcgacgccgagtcggtgcgcgccgtgtatctggtgccgttccaccgggcggag
aggtcgctcgcctccagcctgctgcgcctgctcagcgatgggaacgatcggttgcctcac
ttcgtgggcgtcgactgggccaaggccctggcctggctgagggcgcgcaccggtaacgac
ctcgctcccgagcaggagcaggcggttcggctcgcgctgacctcgaaggtcgcggtgctg
accggtgggccggggtgcggcaagagcttcaccgtccgttccatcgtcgaactcgccgcc
gccaagaaggccaaggtcaccctggtggcgccgaccggacgtgccgccaagcgcctgtcc
gagctgaccggacatcccgccgccaccgtgcatcggttgctgcagctgcgccccggcggg
gacgcctcctacgatcgggacaacccgctcgacgtcgatctgctcgtcgtggacgaggcc
tccatgctcgacctcatcctcgccaacaaactcgtcaaggccgtcccacccggcgcccac
ctgctcctggtcggggacgtcgaccaacttccctcggtcggcgccggcgaggtgctgcgc
gatctgctcgccgcccccaccgttccgcgggtgcggctgacccagatcttccgccaggcc
gcccagtccggcgtcgtcaccaacgcgcatcgcatcaacgccggccgcccacccctgctc
cagggcctgccggatttcttcctgttcgcctgcgacgacaccgaggccgccgccgcccgc
accgtagacgtcgcctgtacccgcatccccgccacgttccggctcgacccccgccgggac
gtgcaggtcctcacccccatgcaccgtggacccgccggctccgggacgctgaacaccctg
ctccagcaacgactcaccccccatcaggaagggctaccggagcggcgcgcgggcgggcgg
gtgttccgcgtcggcgacaaagtcacccagatccgcaacaactatgacaagggtcaggcc
ggtgtcttcaatggcaccctcggcatcgtcaccgatctctcagccgaggaacaaaccctg
acggtacgcaccgacgaggacgagagcatcgactacgacttcgacgaactcgacgagctg
gcccacgcctacgccatgaccatccaccgctcgcagggctccgaataccctgctgtcgtc
atccccctgaccaccagcgcgtggatgatgctgcaacgcaacctgctctacaccgccgtc
acccgcgccaaacaactcgtcgtcctcgtcggctcccgccgggctctcagtgccgctgtc
cgcaccgtcggcgccggccgccgccacaccgcgctcaaccaccgtctggacgccgcgacc
gaccggtag

DBGET integrated database retrieval system