KEGG   Salinispora arenicola: Sare_0287Help
Entry
Sare_0287         CDS       T00613                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
saq  Salinispora arenicola
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sare_0287
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sare_0287
   00052 Galactose metabolism
    Sare_0287
   00500 Starch and sucrose metabolism
    Sare_0287
   00520 Amino sugar and nucleotide sugar metabolism
    Sare_0287
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sare_0287
   00524 Butirosin and neomycin biosynthesis
    Sare_0287
Enzymes [BR:saq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sare_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(320761..321723)
Genome map
AA seq 320 aa AA seqDB search
MGHAATTSAADREVVVALDVGGSGMKCALVRRDGTVTHTEHHLTGAARGPAAVIDTILDV
AEALADTARREGLAPVALGLAVPGVIDEAQGVAIWSANIGFRDVPLRKLAAARLGMPAAL
GHDVRVGGLAEARLGAGRSARHVLFVAIGTGIAAAHVIDGAAAAGAHGAAGELGHVLVRP
GGPRCGCGRDGCLEAVASASAVARRYAELASTAPDAPEASAAEVATRAAAGDPLAQQVWT
DAVEALADGLATGQALFDVEAVVLGGGLARAGAQLLDPLRAALHDRMTFHREPRLVPAAL
GAEAGCLGAALLALDDLEKP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgggccacgcagccacgaccagtgcggcggaccgtgaggtcgtcgtcgcactcgacgtc
ggcggcagcgggatgaagtgcgccctggtccgccgggacggcacggtcacgcacaccgaa
caccacctgaccggcgccgcgcgcggtccggccgcggtgatcgacaccatcctggacgtc
gccgaggccctggccgacacggcccgccgggaaggactcgccccggtggccctcggcctc
gccgtcccgggcgtcatcgacgaggcgcagggcgtggctatctggtcggcgaacatcggc
ttccgcgacgtacccctacggaagctggctgcggcgcggctggggatgccggcggcgctc
ggccacgacgtacgcgtcggcggcctcgccgaggcacggctcggagccggccgctccgcc
cggcacgtcctcttcgtcgccatcggcaccggcattgccgccgcccatgtgatcgatggc
gcggcggcggccggcgcgcacggcgctgccggggagctcggccacgtcctggtccgtccc
ggcggcccacggtgcggctgcgggcgcgacggatgcctggaggcggtcgcgtccgcctcg
gcggtcgcccgccgctacgcggagctggccagcaccgcccccgacgcaccggaggcgagc
gcggccgaggtggccacccgcgccgccgccggtgatccgctggcccagcaggtctggacg
gacgcggtcgaggcactcgccgacggcctcgccaccggccaggccctcttcgacgtggag
gcggtcgtcctgggcggcgggctggcccgagccggcgcccagctgctcgacccgctgcgg
gccgcgctgcacgatcggatgaccttccaccgcgagccacggctggtcccggcggccctc
ggcgccgaggctggctgccttggcgccgccctgctcgccctcgacgacctggagaagcca
tga

DBGET integrated database retrieval system