KEGG   Salinispora arenicola: Sare_0605Help
Entry
Sare_0605         CDS       T00613                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
saq  Salinispora arenicola
Brite
Enzymes [BR:saq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Sare_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
687132..688349
Genome map
AA seq 405 aa AA seqDB search
MNTSPTAPGTSSAATLREQLASTLEQRGHIRSAAVAHAFRTVPREQFLPGVDLETVYTRR
QIVTKRDPSGAALSSASSPSLVADMLEQLAPQPGHRVLEIGAATGINAALLAELTSPDGT
VVTIELDQDLADGARVSLDRAGYDTVKVICGDGALGDPKHGPYDRIIVTAGAWDIAAAWW
EQLADHGRIVVPLRVHESGLTRCFAFDRTSPTTMVSTTTPLVCGFVPMRGSTEHIDHHVR
LDADVVLKLDATDQPDRAALAKALSHPRLERWTGIQASDADPIGHLDLWLLVHANKPFGR
LGVGDTARTSGLVTPAYRWAGAAIYHGGTVAYLAFQDAGNGHHELGAIAHGPDANTLATE
LTNLLDQWDEANRPNQLTVTAHRAGTRPADHGDISRADTILTISF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacttcccccaccgcaccgggaacgtcgagtgccgcgacgctgcgcgaacaactc
gccagcacgctcgaacagcgcggccacatccgctccgctgccgtcgcgcacgcattccgt
acggtgccccgcgagcagttcctccccggcgtcgacctggaaaccgtgtacacccgccgc
cagatcgtcaccaaacgagaccccagcggtgccgcgttgtcgtccgcgtcgagccccagc
cttgtcgcggacatgctcgaacaactcgccccacaacccggacaccgtgtcctggagatc
ggcgcggccaccggcatcaacgccgccctgctcgccgaactgaccagccccgacggcaca
gtcgtcaccatcgaactcgaccaggacctcgccgacggcgcccgcgtcagcctcgaccgc
gccggctacgacacggtgaaggtgatctgcggcgacggtgccctcggcgatcccaagcac
gggccctatgaccggatcatcgtcaccgccggagcctgggacattgccgccgcctggtgg
gaacaactcgccgaccacggccgcatcgtcgtacccctgcgcgtacacgaaagcggcctg
acccgctgcttcgctttcgaccgcaccagccccacgacgatggtgagcaccacgacgccg
ctggtctgcggattcgtccccatgcgcggcagcaccgaacacatcgatcatcacgtacgc
ctcgacgccgacgttgtcctcaaactcgacgccaccgaccagcccgatcgcgccgccctc
gccaaggcgctgagtcacccccggcttgaacgctggaccggcatccaggccagcgacgcc
gacccgatcggccacctcgacctgtggctcctcgtgcacgccaacaagccattcggccgc
ctcggcgtcggtgataccgcccgcaccagcggactggtcacccccgcctaccggtgggcc
ggggccgccatctaccacggcggcaccgtcgcctacctcgccttccaggacgcgggcaac
ggccaccacgaactcggcgcaatcgcccacggcccggacgccaacacgctcgccaccgaa
ctgaccaacctgctcgaccaatgggacgaggcgaaccgccccaaccagctcaccgtcacc
gcgcaccgcgcaggaacccggcccgccgaccacggcgacatcagccgagccgacaccatc
cttacgatctccttctga

DBGET integrated database retrieval system