KEGG   Salinispora arenicola: Sare_0692Help
Entry
Sare_0692         CDS       T00613                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
saq  Salinispora arenicola
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sare_0692
   00052 Galactose metabolism
    Sare_0692
   00500 Starch and sucrose metabolism
    Sare_0692
   00520 Amino sugar and nucleotide sugar metabolism
    Sare_0692
Enzymes [BR:saq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sare_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
765911..766867
Genome map
AA seq 318 aa AA seqDB search
MSEHSANPSSTATTTGGHRAVKAVIPAAGLATRFLPATKAVPKELLPVVDRPVLQYIVEE
ATQAGITDILLVTGRGKTSMIDHFDRRPDLEERLAKKPDLLAAVKQTEDLAAIYSCRQPE
QLGLGHAVGCAESHVGEQPFAVLLGDEFVKPTEPLLPAMLELQARTGGVVLAFFEVDPAE
TTRYGIASVAPAEPEFADIADVVRVTGMVEKPKPEDAPSNLAVLGRYVLPGRIFNAIHRT
EPGSGGEIQLTDAMEILRTEGVPVHAIVYRGTRYDTGMPLGYLQTVVQIAAERDDLGAEF
RKWLAEFVNADEPGGPST
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcactcagcgaacccctcatcgacggccacaacgactggcgggcaccgcgcg
gtcaaggccgtgatcccggccgccgggctcgccacccgcttcctgcccgctaccaaggcg
gtacccaaggaactgctcccggtggtcgatcggccggtgttgcagtacatcgtcgaggag
gcaacgcaggccgggatcaccgacatcctgttggtcaccgggcggggcaagacctcgatg
atcgaccacttcgatcgtcgccctgacctggaagagcggctggcgaagaagcctgacctg
ctagccgccgtcaagcagaccgaggacctggccgccatctactcctgccggcagcccgaa
caactcggtcttgggcatgccgtcggctgcgccgagtcacacgtcggtgagcagcccttc
gctgtgctgctcggtgacgagttcgtgaagccgaccgagccactgctgccggcaatgttg
gagctgcaggcccgtacgggcggggtcgtgctggcattcttcgaggtcgaccccgccgag
accacccgctacggcatcgcctcggtggcgccggccgagccggagttcgccgacatcgcc
gacgtggtccgggtgaccggcatggtggagaagccgaagccggaggacgctcccagcaac
ctcgccgtgttgggccgctacgtgctgcccggtcgcatcttcaacgctatccaccgaacc
gagccgggcagcggtggggagatccaactgactgacgcgatggagatcctccgtaccgag
ggggtgccggtgcacgccatcgtctaccgcggtacccggtacgacaccggcatgccgttg
ggctatctccagaccgtcgtacagattgccgccgagcgtgacgatctcggcgccgagttc
cgtaagtggctcgccgagttcgtcaacgcggacgagccgggtggtccgagtacatga

DBGET integrated database retrieval system