KEGG   Salinispora arenicola: Sare_0707Help
Entry
Sare_0707         CDS       T00613                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
saq  Salinispora arenicola
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sare_0707
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sare_0707
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sare_0707
Enzymes [BR:saq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sare_0707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(785819..787444)
Genome map
AA seq 541 aa AA seqDB search
MLNSLDRRTLLRVAGASAGTAVLASATVAGASPAQAASGAFRHGVASGDPLPDGILLWTR
LTPTEQAQPGSGLGPEAQVSWQVSANPDFTALMAQGTILTGPVRDHTVRVEVTGLEPATT
YWYRFGYEGGWSTTGRTMTAPDVDAEIDRLRMGVVSCSNWEGGYFSAYRYLAERGDLNLV
VHLGDYLYEYGTGELGTGGKVIRPVSPPHETLTLTDYRIRHATYKTDPDLQALHAALPWA
ITWDDHEVANNQWSGGAENHTPGSEGDFAARLAAARQAYLEWMPVRAGVDGAIYRRLRFG
RLADLSMLDLRTYRSKQNWGDVDEPDRTITGDDQMTWLKSGLAASDARWKLVGSSVMISR
LDVGTLPAWLLGPLAKLLGIPQNGIVINTDQWDGYNADRNELVDHLRATDTRDVVFLTGD
IHTSWANELTTKATGPWSPAAAEFVVPSVTTDNVDDFLRLSPDNVVSKLGATLIRATNPH
VRWTELDGHGYGVLEVTPASCRMDWYHLADRTKPTTSSEWVASWSVSAGSAKLREENSPL
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgttgaattcacttgatcgccgcaccctactccgcgtggctggcgcgtcagccggcacc
gccgtcctcgccagcgcgaccgtcgccggggccagccccgcccaagctgccagcggcgcg
ttccgacacggtgtcgcctccggcgaccccctacctgacgggatcctgctctggacccgg
ctgaccccgaccgaacaggcccagcccggctccggcctcggccccgaggcgcaggtgtcc
tggcaggtgtccgccaacccggacttcacggcgttgatggcgcaggggacgatcctcacc
gggcccgtgcgggaccacaccgtccgcgtcgaggtcaccgggctggagccggccaccacg
tactggtaccgcttcggctacgaaggcgggtggtccaccaccggacgcacgatgaccgcg
ccggacgtggacgccgaaattgatcgactgcgaatgggagtggtctcctgctcgaactgg
gaaggcggctacttctcggcctaccggtacctggccgaacgtggcgacctgaacctcgtc
gtacaccttggcgactacctctacgaatacggcaccggagaactcggcaccgggggcaag
gtcatccgtccggtcagtccaccgcacgagacgctcaccctgaccgactaccgcatccgg
cacgccacctacaagaccgacccggacctacaggccctacacgccgcgctgccctgggcg
atcacctgggacgatcacgaggtcgccaacaaccagtggtccgggggtgcggagaaccac
accccgggcagcgagggcgacttcgcggcccggctggccgcggcgcgccaggcgtacctg
gaatggatgcccgtacgcgcgggagtggacggggcgatctaccgccgactccgcttcggt
cggctcgccgacctctccatgctggacctacggacgtaccggtcaaaacaaaactggggc
gatgtcgacgaacccgaccggacgatcaccggcgacgaccagatgacctggctgaagagc
ggcctggccgcctccgacgcgcggtggaagctggtcggcagctccgtgatgatctcccgc
ctcgacgtcggtacgctgccggcctggctgctcggcccgctggccaagctgctgggcata
ccgcagaacggcatcgtgatcaacaccgaccaatgggatggttacaacgccgaccgcaac
gagctggtcgaccatctacgcgccaccgacacccgcgacgtcgtcttcctcaccggggac
atccacacctcgtgggccaacgaactgacgacgaaagccactggtccgtggtcaccggcc
gcggccgagttcgtggtgccatcggtcaccaccgacaacgtggacgacttcctgcgactc
tcgcccgacaacgtggtcagcaagctcggtgcgacgttgatccgtgcgaccaacccgcac
gtgcgctggaccgagttggacgggcacggttacggggtcctggaggtgacccccgcatcg
tgccgaatggactggtaccacctggccgatcggaccaagccgacgacatcaagcgagtgg
gttgccagctggtcggtcagtgcggggtcggcgaagctgcgcgaggagaactcaccactg
tcctga

DBGET integrated database retrieval system