KEGG   Salinispora arenicola: Sare_0727Help
Entry
Sare_0727         CDS       T00613                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
saq  Salinispora arenicola
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:saq00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
809753..810700
Genome map
AA seq 315 aa AA seqDB search
MTEAWRPDGDEPRGVSGPFRVRVPAKINLHLGVGPLRPDGYHELNTVYHAISIHDELTAR
RGDTLALTMEGEGAGELALDDSNLVIRAARALAAHAGVPPYARLHLRKQIPLAGGLAGGS
ADAAAALVACDALWGTGLSRDELAGIAADLGSDVPFLIHGGTALGTGRGEAVSPVLARPT
VWHWVVAVADGGLSTPVAYRELDRLRDAGAASTPLGSSDALLAALRQRDPRVLAGVLGND
LQDAALALRPSLAATLKAGEAAGALAGIVSGSGPTCVFLAANAADAERVAGELSALDVCR
QARTARGPVAGARVG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaggcatggagacccgatggcgatgaaccgcgaggcgtcagcgggccgttccgc
gtacgggtgcccgccaagatcaatctgcatctcggggtgggaccactgcgccccgacggt
tatcacgagttgaacaccgtctatcacgcgatctccatccacgacgaactgaccgcccgc
aggggcgacacccttgccctgacgatggagggtgagggggccggtgagctggccctggac
gactccaacctggtcatccgcgcagcccgcgccctcgccgcacacgccggggtgcctcca
tatgcccggctgcacctgcgcaagcagatccccctggccggtgggctggccggcggcagc
gccgacgccgccgccgcgctggtcgcctgcgacgcactctggggaaccgggctgtcccgc
gacgaactggcggggatcgccgccgacctcggctccgacgtgccgtttctgatccacggt
ggcaccgcgctgggcaccggccgaggggaggcggtcagcccggtactggcccggccgacc
gtatggcactgggttgtcgcagtcgccgacgggggcctgtccacgccggtcgcgtaccgg
gaactcgatcggctccgggacgccggcgccgccagtacgccgctcggcagtagcgacgcc
ctgctggccgccctccggcagcgggacccccgggtgctcgccggggtcctcggcaacgat
ctccaggatgccgcgcttgccctgcggccgtccctggccgccaccctgaaggcgggcgag
gcggcgggtgcgctcgcgggcatcgtctccggctccgggccgacctgcgtgttcctcgcc
gccaacgcggccgacgcagagcgcgtagccggtgagttgagcgccctcgacgtgtgccga
caggcgcgcaccgcgcgcggcccggttgccggggcccgggttggttga

DBGET integrated database retrieval system