KEGG   Salinispora arenicola: Sare_0756Help
Entry
Sare_0756         CDS       T00613                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
saq  Salinispora arenicola
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:saq00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
841700..842980
Genome map
AA seq 426 aa AA seqDB search
MVDFTAVDIIRAKRDGEAFSDAQVDWVVDAYTRGQVADEQMAALAMAILLNGMTTPEIAR
WTAAMIASGERLDLAAVDRPTVDKHSTGGVGDKITLPLTPLVAACGAAVPQLSGRGLGHT
GGTLDKLESIRGWRASLGNEEFIAQLRGVGAVICAAGAGLAPADRKLYALRDVTGTVEAI
PLIASSIMSKKIAEGTGALVLDVKVGSGAFMKSVDQARQLARTMVELGSAHDVRTVALLT
DMSTPLGLAIGNAVEVAESVEVLAGGGPADVVELTLALAREMLEAAGLPDADPATALRDG
RAMDSWRAMLRAQGGDPDAPLPTAPETEVVRADTDGVVAEVDAFGMGVAAWRLGAGRARK
EDPVSAPAGVLLRKRPGDPVRAGDPLFELRAEDAARIPAAREEAVRAVRIAASTPEPRPL
VLERIG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggtggattttacggcagttgacatcattcgggccaaacgggacggcgaggcgttctcc
gacgcgcaggtcgactgggtggtggatgcctatacccgaggtcaggtggcggacgaacag
atggccgcgctggcgatggcgatcctgctgaacgggatgaccacgccggagatcgcccgg
tggaccgcggcgatgatcgccagcggtgagcgactggacctcgccgcggtcgatcggccg
accgtcgacaaacactccaccggtggtgtcggagacaagatcaccctgccgctcaccccg
ctggtggcggcctgcggcgcggcggtgccgcagctgagcggtcggggactcgggcacacc
ggtggcacgctcgacaagctggagtccatccggggctggcgggcgtcgctgggcaacgag
gagttcatcgcccagctccgcggtgtcggcgcggtgatctgcgcggccggcgccggtctc
gcgccggccgaccgcaagctgtacgcgctgcgggacgtgaccggcacggtggaggccatc
ccactcatcgccagttcgattatgagcaagaagatcgctgaggggaccggtgccctggtc
ctggacgtcaaggtcggctccggtgcgttcatgaagtcggtcgaccaggcccggcaactg
gcccgcaccatggtcgagttgggcagcgcgcacgacgtacgcacggttgccctgctcacc
gacatgtccaccccactagggctggccatcggcaacgcggtcgaggtggccgaatcggtc
gaggtactggcgggtggtggaccggccgacgtggtcgagctgaccctggccctggcccgg
gagatgctcgaagccgccggtctaccggatgccgacccggcgacggcgctgcgcgacggc
cgggcgatggactcctggcgggcgatgctgcgggcccagggcggggatccggatgccccg
ctgcccacggcgccggagaccgaggtggtgcgcgccgacaccgacggtgtggtggcggag
gtcgacgcgttcggcatgggggtggccgcgtggcggctcggcgccgggcgggcccgcaag
gaggacccggtgtccgcgccggcgggcgtgctgctgcgcaaacgccccggcgatccggtc
cgggccggtgacccgctcttcgagctgcgggccgaggacgccgctcggatcccggcggcc
cgggaggaggcggtgcgggcggtgcgtattgcggcgtcgaccccggagccgaggccactg
gtgctcgaacgaatcggctga

DBGET integrated database retrieval system