KEGG   Salinispora arenicola: Sare_1094Help
Entry
Sare_1094         CDS       T00613                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
saq  Salinispora arenicola
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sare_1094
Enzymes [BR:saq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sare_1094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1231713..1232603
Genome map
AA seq 296 aa AA seqDB search
MPQTRVVVVGSANMDLVATAPALPQPGETLLGADFVMVPGGKGANQAIAAARAGADCTFL
GAIGSDAFGVTLRARITAAGVDTGHLRVAYGASGVALVMVNAEGENAIVVSPGANATMKG
LTEPELTAVREADVLVAQLEIPVETVTEAAVVARAAGTRVVLNAAPARTVPPELFAATDV
LVVNESEALAFTGRGEPRALLELTPRAVLTLGMSGAWYGDRDGECVRVPAVPVEAVDSTA
AGDAFSAALAVGWGEGRDLVDAVRWATAAGAACVRRLGASVALPRRAEIDELYQPG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagacccgggtggtcgtcgtcggcagtgccaacatggacctcgtggcgaccgct
ccggccctgccccagccgggtgagacgctgctcggcgcggacttcgtcatggtccccggc
ggcaagggtgccaaccaggccatcgcggcggcgcgagccggtgcggactgtacgttcctc
ggcgccatcggctccgacgcgttcggcgtcaccctccgcgcccgcatcaccgcggccggg
gtggacaccggccacctgcgggtcgcctacggcgcctccggcgtcgccctggtgatggtc
aacgccgagggcgagaacgccattgtggtcagtcccggtgccaacgccacgatgaaaggg
ctgaccgagccggagctgaccgccgtgcgcgaggcggacgtgttggtcgcacagctggag
attccggtggagaccgtcaccgaggcggcggtggtggcccgtgcggccggcacccgcgtg
gtgctcaacgccgcacccgcccggaccgtgccgccggagctgttcgccgccaccgacgtg
ctcgtggtcaacgagagcgaggcgctggcgttcaccggtcggggggagccgcgggccctg
ctcgagctgacgccccgggcggtgctcacgcttgggatgtccggtgcctggtacggcgac
cgggacggtgaatgcgtgcgcgtcccggcggtcccggtcgaggcggtcgactcgacggcg
gccggggacgcgttctcggccgcgctcgcggtcggttggggggaggggcgggatctggtg
gatgcggtgcggtgggcgacggcggccggcgcggcctgtgtccggcggctcggtgcctcg
gtggcgttgccccgtcgcgccgagatcgacgagttgtaccagccgggctga

DBGET integrated database retrieval system