KEGG   Salinispora arenicola: Sare_1419Help
Entry
Sare_1419         CDS       T00613                                 

Definition
beta-lactamase
Orthology
K17836  
beta-lactamase class A [EC:3.5.2.6]
Organism
saq  Salinispora arenicola
Pathway
Penicillin and cephalosporin biosynthesis
beta-Lactam resistance
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Sare_1419
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Sare_1419
Enzymes [BR:saq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     Sare_1419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1640871..1641788)
Genome map
AA seq 305 aa AA seqDB search
MSVSGVLREARELLEEAGLHGAFLVRNLDTGDEIGLDADVPYPAASLVKVPLALAVLERV
ARGELDLATAVDIAPGPITTGTTGLSRFRHPARIALDDLLYLSIAISDGVAADALFDLTP
PAAVAAELRRLRIEGIAVRHRISDLTDTPAERLRPDEAHLAHALAISAATSGNGHPVAQL
DVARANAGSARAFVDLLHAVWRPAAIDGATAARVRDLMADNVLRQRLAPDFTSDASRWSS
KTGTLLHLRHEVGVVDHADGQSYAVAALTASRVPAVAQPGSEATMAHVARVLHGYLRTGA
PPWWG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtctccggcgtgctgcgcgaggcgcgcgaactactcgaggaggcggggctgcac
ggagccttcctggttcgcaatctcgacacgggggacgagatcggcctcgacgcggacgtc
ccctatccggcggcgtcgctggtgaaggtgccgctggcgctcgctgtgctggaacgggtg
gcgcgcggagagctcgacctggcgacggcggtcgacatcgcgcccggcccgatcaccacg
ggcaccaccggactgagccgatttcgccaccccgcccggatcgccctggacgacctgctc
tacctgagcatcgccatcagcgacggggtcgccgccgacgccctgttcgatctcacccca
cctgccgcggtcgccgccgagctgcggcgactgcgcatcgaaggcatcgccgtacggcac
cggatcagcgacctcaccgacactccggcggaacggctccgaccggatgaggcgcacctg
gctcatgctctcgccatcagcgccgcgacctccggaaacggccaccctgtcgcccaactc
gacgtcgcccgcgccaatgccgggtcggcgcgggccttcgtcgacctgctgcacgccgtc
tggcgacccgcggcgatcgacggggcgaccgcggcacgggtacgcgacctgatggcagac
aacgtgctccggcaacgactcgcacccgacttcacctccgacgcctcgcgctggtcctcg
aagaccggcacactgctgcacctgcgacacgaggtgggggtggtggaccacgccgacggg
cagtcgtacgcggtcgccgcgttgaccgcctcccgcgtgcctgccgtcgcgcagccgggc
agcgaggcgaccatggcgcatgtcgcgcgggtgctgcacggctatctgcgcacgggcgcc
ccgccctggtggggttag

DBGET integrated database retrieval system