KEGG   Salinispora arenicola: Sare_1475Help
Entry
Sare_1475         CDS       T00613                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
saq  Salinispora arenicola
Pathway
saq00860  Porphyrin and chlorophyll metabolism
saq01100  Metabolic pathways
saq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sare_1475
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Sare_1475
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Sare_1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 NAD_binding_9 HI0933_like MCRA FAD_binding_2 Pyr_redox FAD_oxidored Thi4 Trp_halogenase FMO-like GIDA
Motif
Other DBs
NCBI-ProteinID: ABV97373
JGI: Sare1475
UniProt: A8LUM0
Position
1705084..1706493
Genome map
AA seq 469 aa AA seqDB search
MATPWRIAVVGGGIAGLAAAVQLRDHAPEGTEVTVYERSGALGGKLHTGELAGGPVEFGA
EAFLMRDASGGESAVVSLIRRLGLADDIVHPTVGQAALLAGGELHPVPRGTLVGVPGDLA
AAAAVARPTAEADVDTGRPLLAPGADVTVGELVRGRLGDEVVDRLVDPMLGGVYAGRADD
LSLAATMPALARQARVEHTLVGAVRAAQAAAPRAPGTPFFGTLAGGLSTLVEAAAAASGA
TIQRNATVRALTPAEAGWRLTIGPNGDADHVQADAVVLAVPASPAARLLDDVAPAVAENI
GALAYASVALVTLALPEATLPALSGFLVSTGEGLVMKASTFFTTKWGHLRRPDGLALVRA
SVGRLGDEAQLQRPDADLVATTHRELSTVLGDALPTPVATHVQRWGGSLPQYAPGHLDRV
GSARAVLRAERPTLALAGAGYDGVGIPVCVRSGMAAADEIITALKGSGE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaccatggcggatcgcggtggtcggcggcgggatagccggcctcgccgccgcc
gtccaactgagggaccacgctcccgaaggcaccgaggtgacggtgtacgagcgaagcggc
gcgctcggcggcaagctgcacaccggtgagctggccggcgggccggtggagttcggcgcg
gaagcgttcctgatgcgggacgccagcggcggtgagtccgctgtggtgtccctgatccgt
cggctcgggctggccgacgacatcgtccaccccaccgtcgggcaggcggcgctcctcgcc
ggcggcgagctgcatccggtgccccgcggcacgctggtcggcgtacccggggacctcgcg
gcggcggcggcggtggcccgcccgaccgcggaggccgacgtggacaccggtaggccgttg
ctcgcccccggtgccgacgtcaccgtcggggagttggtccgcggccggctgggcgacgag
gtcgtcgaccggttggtcgatccgatgctcggtggcgtctacgccggccgcgctgacgac
ctctccctggccgcgaccatgcccgcgctggcccggcaggcccgggtcgagcacaccctc
gtcggcgcggtccgcgcggcgcaggccgcggcaccgcgggcaccgggcacgccgttcttc
ggcaccctggccggtggtctgagcaccctggtcgaggccgcggccgcggccagcggcgcc
acgatccagcggaacgcgacggttcgtgcgctgaccccggcggaggccggctggcgactg
accatcgggccgaacggcgacgcggaccacgtccaggccgacgccgtggtgctggccgtg
ccggccagcccggcggcgcggcttctcgacgacgtcgccccggccgtggcggagaacatc
ggcgccctggcctacgccagcgtcgcgctggtcactctcgcgttgccggaggcgacgctg
cccgcgctctccggcttcctggtgtcgaccggcgaggggctggtgatgaaggcctccacc
ttcttcaccacgaagtgggggcacctgcgtcggccggacgggctggccctggtccgtgcc
tcggtcgggcggctcggggacgaggcgcagctccagcgccccgacgcggacctggtcgcc
acgacgcaccgagagttgtcgacagtgctcggtgacgcgcttcccacgccggtcgccacg
cacgtgcagcgctggggcgggtcgctgccgcagtacgcgccgggccacctcgaccgggtg
gggtcggcgcgggcggtgctgcgggcggagcggccgaccctggcgttggcgggtgccggc
tacgacggcgtcggcattccggtctgtgtccgttccggcatggcggcggctgacgagatc
atcactgcactgaagggttccggggaatga

DBGET integrated database retrieval system