KEGG   Salinispora arenicola: Sare_1533Help
Entry
Sare_1533         CDS       T00613                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
saq  Salinispora arenicola
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sare_1533
Enzymes [BR:saq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Sare_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1767167..1769569)
Genome map
AA seq 800 aa AA seqDB search
MDSATAQDRPLTETELRRLDAYWRAANYLTVGQIYLRSNPLLREPLTPEHVKPRLLGHWG
TSPGLNLLYAHLNRVIVARDLNAIYITGPGHGGPAIVANTWLEGTWSELYHGTGRDEAGM
AQLFCQFSFPGGIPSHVAAEVPGSIHEGGELGYALSHAYGAAFDNPDLLVACVIGDGEAE
TGPLAGSWLSNVFLNPARDGAVLPILHLNGYKIANPTVLDRIPESELLDLLRGYGHHPYL
VAGEDPATVHQALAATLDRALDEIAAIQRRARSGGPVERPRWPMIVLRTPKGWTGPREVD
NTPVEGTYRAHQVPLSQVRSNPQHLAELERWLRSYHPEELFDATGAPVAELIALPPKGDR
RMSANPVANGGQVLRDLVLPDFRDYAVDVPRPGEPVTSATGALGTWIRDVIAANPESFRL
FGPDEVASNRLGAAFEVTDRAWVAETVPGDDHLSPDGRVMEVLSEHLCQGWLEGYLLTGR
HGLFTSYEAFIHIVDSMVNQHAKWLKVTRGIPWRQPLASLNYLLSSHVWRQDHNGFSHQD
PGFIDHVMNKKAEVVRVYLPPDGNTLLSTLNHCLRSRHYINVVVAGKQPTPNWLPMDEAI
LHCRRGIGIWGWASNDGDSEPDVVLACAGDVPTLETLAAADLLHQHLPDLKVRVVNVVDL
MRLQPSSEHPHGLPDTEFDTIFTTDKPIIFAYHGYPWLIHRLTYRRTNHPNLHVRGYKEE
GTTTTPFDMVMLNDLDRFHLVIDVIDRVPGLAARAAHLRQAMVDARQSCRDYTRAHGADD
PRVAQWRWTRGTDADDSDDR
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgcaaccgcccaggaccgccccctgaccgagaccgagctgcgccggctggac
gcgtactggcgggcggcgaactacctcaccgtcgggcagatctacctccggagcaatccg
ctgctgcgcgaaccgctgacgccggagcatgtcaagccgcggctgctcgggcactggggc
accagccccggcctgaacctgctgtacgcgcacctcaaccgggtcatcgtcgcccgtgac
ctgaacgccatctacatcaccgggcctggccacggcggtcccgcgatcgtggcgaacacc
tggttggagggcacctggagcgagctctaccacggcaccggccgagacgaggccggcatg
gcgcagctgttctgccagttctccttccccggtggcattcccagccacgtggccgcggag
gtgccggggtcgattcacgagggcggtgagctcgggtacgcgctcagccacgcctacggg
gccgcgttcgacaacccggacctgctggtcgcgtgcgtgatcggtgacggtgaggcggag
accgggccactggccggcagttggctgtccaacgtgttcctgaatccggcccgcgacggc
gcggtgctgccgatcctgcacctcaacggctacaagatcgccaacccgacggtgctggac
cggatccccgagtccgagttgctggatctgctgcgcggatacggccaccatccatacctg
gtcgccggggaagatcccgccaccgtgcaccaggcgctcgccgcgaccctggaccgggcc
ctggacgagatcgccgccatccagcggcgggcccggtcgggtggcccggtcgagcgcccc
cgttggccgatgatcgtgctgcgcacgccgaagggctggaccggcccccgggaggtcgac
aacacgccggtggagggcacataccgtgcacaccaggtgccgctgtcgcaggtacgcagc
aacccgcagcacctggccgagttggagcgctggctgcgcagctaccacccggaggagctc
ttcgacgcgaccggggcgccggtcgccgagctgatcgcactgccgccgaagggtgaccgc
cggatgagcgccaacccggtcgccaacggcgggcaggtgttgcgtgatctggtcctgccg
gatttccgcgactacgcggtcgacgtgccacggcccggcgagccggtcaccagcgccacc
ggcgcgctcggcacctggatccgcgacgtcatcgccgcgaacccggagtcgttccggctc
ttcggcccagacgaggttgcctcgaaccggctcggtgccgccttcgaggtcaccgaccgg
gcctgggtggcggagaccgtacccggcgacgaccacctctccccggacgggcgggtcatg
gaggtactctccgagcacctgtgccagggctggctcgaggggtacctgttgaccggccga
cacggcctgttcaccagctacgaagcattcatccacatcgtcgactcgatggtcaaccaa
catgccaagtggctgaaggtcacccggggcattccctggcggcagccgctggcctcactg
aactacctgctgtccagccacgtctggcggcaggaccacaacggcttctcccaccaggac
ccggggttcatcgaccacgtgatgaacaagaaggccgaggtggtccgggtctacctgccg
ccggacggcaacaccctgctctccacgttgaaccactgcctgcgtagccggcactacatc
aacgtggtcgtcgccggcaagcaaccgacaccgaactggctgccgatggacgaggcgatc
ctgcactgccggcgcggcatcggcatctggggctgggccagcaacgacggcgattcggag
ccggacgtggtgctcgcctgcgccggtgacgtgcccacactggaaaccctcgcggcggcc
gacctgctgcaccaacacctgcccgacctgaaggtgcgggtggtcaacgtggtcgacctg
atgcgcctccagccgtcgagcgagcacccgcacgggctgccggacacggagttcgacacc
atcttcaccaccgacaagccgatcatcttcgcgtaccacggctacccgtggctcatccac
cgcctgacctaccgacggaccaaccaccccaacctgcacgtgcgcggctacaaggaggag
ggcaccaccaccactccgttcgacatggtgatgctcaacgacctggaccggttccatctg
gtcatcgacgtgatcgaccgggtacccggcctcgccgcgcgggccgcgcacctgcggcag
gcgatggtcgacgcacgccagtcgtgccgggactacacccgcgcgcacggcgccgacgac
ccacgggtggcgcagtggcggtggacccgcgggacggacgccgacgacagcgacgaccga
tga

DBGET integrated database retrieval system