KEGG   Salinispora arenicola: Sare_1755Help
Entry
Sare_1755         CDS       T00613                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
saq  Salinispora arenicola
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:saq00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:saq00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2027229..2028728
Genome map
AA seq 499 aa AA seqDB search
MTMPEGNLQSLAATVLQPGFVGTTAPTWVRRWLGDGLGAVVLFARNVVDSDQVAALTATL
RAERPDVIVAIDEEAGDVTRIESGLGSSRPGNLALGVVDDPALTEAVASDLGAELAALGI
TLNYAPDADVNSDPDNPVIGVRSFGADPARVARHTAAWVRGLQASGVAACAKHFPGHGDT
RIDSHHDLPRIVGDRTRLDAVELAPFRAALSAGVQAVMSGHLLVPVLDPDLPASLSRRIL
TGLLRDELGFAGVVVTDAVEMRAVADRYGFAGAAVRALAAGADAICVGGERADEDAAQQL
RDAIVAAVVAGELPEERLVEAAKRVSLLASWTAASRGARPARQPAPGGGSAVGFAAARRA
VRITTGGAGRGTLPLTGPAHVVEFESPRNIAIGAETPWGVAAPLAELLPGTTAVRYAEDD
APTDPVAGAHGRHVVLVVRDLHRHPLVRAAVTRALAARPDAVVVELGVPELVTGAVHVAT
HGATRASSRAAAEVLTGAG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgcccgaaggcaacctccagtccctggccgccaccgttctccaacccggcttc
gtcggtaccaccgccccgacctgggtgcgccgctggctgggcgacgggctcggcgcggtg
gtgctcttcgcccgcaacgtggtcgactccgaccaggtcgccgcgctgaccgcgacgttg
cgcgcggaacgaccggacgtcatcgtcgccatcgacgaggaggccggcgacgtgacccgg
atcgagtcggggctgggcagctcccggcccggcaacctggcgctcggcgtggtcgacgat
ccggccctgaccgaggcagtggccagcgacctcggcgcggagctggcggcgctcgggatc
accctgaactacgcgccggacgccgacgtcaactccgatccggacaacccggtgatcggc
gtccgttccttcggtgccgacccggcccgtgtcgcccggcacaccgccgcctgggtgcgg
ggcctgcaggccagcggcgtcgcggcctgcgccaagcactttcccgggcacggtgacacc
cggatcgactcccaccacgacctgccccggatcgtcggcgaccgaacccggctggatgcc
gtggaattggcaccgttccgcgccgcgttgtccgccggcgtgcaggcggtgatgagcggc
cacctgctcgtacccgtactggatccggatctgccggccagcctgagccgccggatcctc
accggcctgctccgcgacgagttgggattcgccggggtcgtggtgaccgacgcggtggag
atgcgcgcggtcgccgaccgctacggcttcgcgggtgccgcggtgcgtgccctggccgcg
ggcgccgacgccatctgcgttggcggcgagcgcgccgacgaggacgcggcccagcagcta
cgggacgcgatcgtggccgctgtcgtggccggggaactgcccgaggaacggctcgtcgag
gcagccaaacgggtcagcctgctcgcctcctggaccgccgccagccgcggggcccggccg
gcgcggcagccggcacccggcggtggctcggccgtcggattcgccgccgcccggcgggcc
gtccggatcacgacgggcggtgccgggcgggggacgctgcccctgaccggccccgcccac
gtggtggagttcgagtccccccggaacatcgcgatcggcgcggagacaccgtggggcgtc
gcggcaccgctggccgagctgctgccgggcaccaccgctgtccggtatgccgaggacgac
gcgcccaccgatcccgtcgccggagcgcacggtcgccacgtcgtcctcgtcgttcgggac
ctgcaccgccacccgttggtgcgggcggccgtgacgcgtgccctggccgcccgcccggac
gccgtggtcgtcgagctgggtgtgcccgaactcgtcaccggggcggtgcacgtggcgacc
cacggtgcgacccgtgccagcagccgggccgcggcggaggtcctgaccggggccggctga

DBGET integrated database retrieval system