KEGG   Salinispora arenicola: Sare_1797Help
Entry
Sare_1797         CDS       T00613                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
saq  Salinispora arenicola
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:saq00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:saq00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2070319..2071101)
Genome map
AA seq 260 aa AA seqDB search
MTADPRTTPHVVQVDLTGRTALVTGGGSGIGRTCARRLGAAGATVVVVDRDLAAARAVAA
EVGGRAVGVDLADPEAVDRLDTNVDIVVNNAGLQHVAPVEEFAVERFEHLHRVMVQAPFL
VIRRALPHMYAERWGRIVNISSVHGLRASPYKAAYVSAKHALEGLSKVVALEGAGHGVTA
NCISPAYVRTALVQDQIVDQAAIHGISETEVVEKIMLARAAIKRLIEPEEVAELVAYLCS
PPAAFITGASIALDGGWTAN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagatcccaggacgaccccccacgtcgtacaggtcgatctcaccggccggacc
gccctggtgaccgggggcgggagcggcatcggacggacgtgcgcgcggcggctgggcgcg
gccggcgccacggtggtcgtggtggaccgtgacctcgccgcggcccgggcggtcgccgcc
gaggtgggcggccgggccgtgggcgtcgacctggcggacccggaggcggtcgaccgcctc
gacaccaacgtcgacatcgtggtgaacaacgccggactccagcacgtcgccccggtcgag
gagttcgccgtggaacgcttcgaacacctgcatcgggtgatggtccaggccccgttcctc
gtcatccgccgggccctgccacacatgtacgccgaacggtgggggcgcatcgtcaacatc
tcctcggtgcacgggctgcgcgcctcgccgtacaaggcggcgtacgtgtcggcgaaacac
gcgctggaggggctgtccaaggtggtggcgctggagggcgccgggcacggggtgacggcc
aactgcatcagcccggcgtacgtgcgcaccgcgctggtgcaggaccagatcgtggaccag
gccgccatccacggcatctcggagaccgaggtcgtcgagaagatcatgctggctcgggcg
gccatcaagcggctgatcgaaccggaggaggtggccgagttggtggcgtacctgtgctca
ccaccggcggcgttcatcaccggtgcgtccatcgcgctcgacggaggctggacggcgaac
tag

DBGET integrated database retrieval system