KEGG   Salinispora arenicola: Sare_1854Help
Entry
Sare_1854         CDS       T00613                                 

Definition
(GenBank) guanylate kinase/L-type calcium channel region
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
saq  Salinispora arenicola
Pathway
saq00230  Purine metabolism
saq01100  Metabolic pathways
Module
saq_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sare_1854
Enzymes [BR:saq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sare_1854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin
Motif
Other DBs
NCBI-ProteinID: ABV97739
JGI: Sare1854
UniProt: A8LY22
Position
2139858..2140391
Genome map
AA seq 177 aa AA seqDB search
MSTDGEARPAARLTVLAGPSGSGRGGVVGLVRARLPSVWTPVPVTTRPRRDREVAGVERS
FLDPVTFDRLLAAGGLLEWSQIGPYRRGTPQEPLRSRLAAGEPALLAMDLAGALLVRAVL
PEAQLVLLHPPDYVPDPNTEAHFAHTVVHSRTVQVVDELVGLFGSSFKAPARPRVRG
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacggatggcgaggcgcgcccggcggctcggctcaccgtcctggccggaccttcg
ggttccggtcggggtggtgtcgtcgggttggtccgggcgcgtctgccttccgtgtggacg
ccggtaccggtgaccacccggcctcggcgtgaccgcgaggtggccggagtcgagcgcagt
tttctcgatccggtcacgttcgaccgtctgttggccgcgggtggactgctggagtggagc
cagatcggcccgtatcggcgcggcacgccgcaggagccgctgcggtcccgcctggccgcc
ggtgagccggcccttctggcgatggacctggccggggcgctgctggtccgggctgtgctg
cccgaggcccagctggtcctgctgcacccacccgactacgtgcccgatccgaacaccgag
gcgcatttcgcgcataccgtcgtgcacagccggaccgtgcaggtcgtggacgagctggta
ggattgttcggttcgtcattcaaagctccggcgcgaccgcgcgtgcgcggttga

DBGET integrated database retrieval system