KEGG   Salinispora arenicola: Sare_1956Help
Entry
Sare_1956         CDS       T00613                                 

Definition
phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
saq  Salinispora arenicola
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Sare_1956
Enzymes [BR:saq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Sare_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2250084..2250920)
Genome map
AA seq 278 aa AA seqDB search
MTADILRRALTAGTGAPVRAVGASNALAATAAAGAGFDALWVSSLEVSAAAGLADANVLG
VRDLCDVVLAVGRTAHLPVVVDVDNAGGSANSARRCAFDLARTGAAALCLEDSAYPKCNS
FSTHRAQGLTDVNVVADQLREMRRASDELVLIARTEALIAGAPFSHALDRARYYAANGAD
AVLIHSRDVSGDEALRTAREWSAPTPLVTVPTAFAHLGWQELGRAGFAMCIYANQLSRAA
LAGMRAVAAELVGTGSPGTVPLATVGELLAIGDPYAHV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctgacattctgcgccgggcattgacggcgggtaccggcgccccggtccgggct
gtcggcgcatccaacgccctcgccgctactgccgccgccggtgctggcttcgatgcactg
tgggtcagcagcctggaggtctccgccgccgccggcctcgccgacgcgaacgtgctcggg
gtgcgtgacctgtgcgacgtggtgctcgccgtcgggcgcaccgcccacctgcccgtggtg
gtcgacgtcgacaacgccggcgggtccgcgaactccgcccgccgctgcgctttcgacctg
gcccgcacgggcgctgccgcgctgtgcctggaggacagcgcctacccgaagtgcaacagc
ttcagcacccaccgcgcgcagggtctgactgacgtcaatgtcgtcgcggaccagctgcga
gagatgcgccgggccagcgacgaactggtgctcatcgcccgcacggaggcgctgatcgcc
ggcgcacccttctcccacgccctggaccgagcccggtactacgctgcgaacggcgcggac
gcggtactgatccactcccgtgacgtctcaggagacgaggcgctgcgcacggcgcgggaa
tggagcgcaccgaccccgctagtcaccgtgccgaccgcctttgcccacctcggatggcaa
gagctgggccgggccggtttcgccatgtgcatctacgccaaccagctcagccgcgcagcc
ctagcgggcatgcgcgccgtcgccgcggagctggttggcaccggctcgccgggcacggtg
ccgttggccaccgtgggcgagctgctggcgatcggcgacccctacgcccacgtctga

DBGET integrated database retrieval system