KEGG   Salinispora arenicola: Sare_2101Help
Entry
Sare_2101         CDS       T00613                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K21190  
dehydrogenase
Organism
saq  Salinispora arenicola
Pathway
Biosynthesis of enediyne antibiotics
Module
Maduropeptin beta-hydroxy acid moiety biosynthesis, tyrosine => 3-(2-chloro-3-hydroxy-4-methoxyphenyl)-3-hydroxypropanoyl-PCP
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    Sare_2101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2421657..2422679)
Genome map
AA seq 340 aa AA seqDB search
MKAAVIPEFNGTWELREVPTPVPGPGEVLIRVRASGVCYNDFLATCGGIPFPTVSPAVTG
HEPVGEVAEVGPDVTSRQVGDRVGATWVRAGCGRCDYCQRNLPVSGQTAINCPSPTTTGF
SVLGGHAEYLVTRADETVLIPDGLPFELAAPVMCAGYTAWSALRAANPLPHERVAVLGIG
ALGHLAVQFARATGFETVAITRSVDKHDAIRRLGADHIVGSGEELRELGGADVILATSPS
YAAAGAALQGLRVNGRMVLAGIDGQEPFTIPAAVTYPFFALGQRIISATHDGPRYLTEAL
NLVASGKVAPVVERFPAERVAEAVAKVAKGDVRFRAVVTY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagccgtcattcccgaattcaacggcacctgggaactacgtgaggtgccgacg
ccggtgccggggccgggcgaagtcctgatccgggtacgtgcctctggtgtctgctacaac
gacttcctcgccacctgcggtggaattccgttcccgacggtcagcccggcggtcaccgga
cacgagccggtcggcgaggtggccgaggtggggcctgacgtcacgtctcggcaggtcggt
gatcgggtcggggccacctgggtccgggcaggctgcgggcggtgcgactactgccagcgc
aacctgccggtgtccggccagaccgcgatcaactgcccgtcgccgaccaccaccggcttc
agtgtgctgggcgggcatgccgaatacctggtcaccagggccgacgaaaccgtgctcatc
ccggacgggctccccttcgaactcgccgcaccagtgatgtgcgccgggtacacggcctgg
tcggcgctgcgtgcggcgaacccgctgccgcacgagcgggtcgcggttctcggcatcggc
gccctcggccacctggcggtgcagttcgcccgggccaccgggttcgagaccgtcgccatc
acccggtcggtggacaaacacgacgccatccgccggctcggcgccgaccacatcgtcggc
agcggcgaggaactgcgggaactgggcggagccgacgtcatcctggctacctcaccgtcc
tacgctgcggccggtgcagccctgcaagggctgcgggtcaacggacgaatggtgctcgcc
ggcatcgacggacaggagccattcaccatcccggcagcggtgacgtacccgttcttcgcg
ctggggcaacgcatcatcagcgcgacccacgacggcccccggtacctcaccgaggcgctg
aaccttgtggcatccgggaaggtcgcaccggtggtggagaggttccccgccgagcgggtc
gccgaagccgtcgccaaggtggccaagggcgacgtccggttccgcgccgtggtcacgtac
tga

DBGET integrated database retrieval system