KEGG   Salinispora arenicola: Sare_2240Help
Entry
Sare_2240         CDS       T00613                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
saq  Salinispora arenicola
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sare_2240
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sare_2240
   00020 Citrate cycle (TCA cycle)
    Sare_2240
   00620 Pyruvate metabolism
    Sare_2240
Enzymes [BR:saq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sare_2240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2576265..2577557
Genome map
AA seq 430 aa AA seqDB search
MSERVFLLPDLGEGLSEAEIVEWRVAVGDTVTVDQAVVEVETAKAVVDVPCPYAGRVVAL
HGTAGEVRPVGQPLITIAPLDVADGASGEPVGHAVYREEERAGSGNVLVGYGAGHGATAR
RRRRPRPAPGGTAPGNGAGPSGGSVRVISPIVRRLAKQRGVDLAALRGTGRGGVIRRADV
EAAVSAPAVAVPDAQVAPGDSDVIVPLTGIRKVIADKLARSRREIPEVTIWVDADATALL
ETRAAINAATPGEPVSILALFARICLSGLRKFPELNARVDSAAQRIVQSAGVHLGIAAQT
DRGLVVPVLRDAQRLTTAGLAAALAETTAAARAGTLPPTRLTGGTFTLNNYGVFGVDGST
PIINHPEAALLGVGRIVDKPWVVDGQLAVRKVTQISLTFDHRVCDGGVAGGFLRHVADCV
ERPPLLIANI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcgggttttccttctgccggacctcggggaagggctgagtgaggcggagatc
gtcgagtggcgggtcgccgtgggcgacacggtgacggtggaccaggccgtcgtggaggtg
gagaccgccaaggcggtcgtcgacgttccctgcccgtacgccgggcgggtggtggcgctg
cacggcacggcgggcgaggtacggccggtcggccagcccttgatcaccatcgcgccgttg
gatgtggccgacggcgcttccggagagcctgtcgggcatgcggtctaccgtgaggaggag
cgggctggctccggaaacgtcctggtcgggtacggtgccggccacggcgcaaccgctcgt
cggcgccgtcggccgcgcccggcaccggggggcacggccccgggtaacggcgccggcccg
tccggcggtagcgtccgggtcatctcgccgatcgtgcggcggttggcgaagcaacgtggc
gtcgacctggccgcgctgcgcggcaccggtcgcggtggcgtgattcggcgtgctgacgtg
gaggccgccgtttcggccccggctgtggccgttcccgacgcgcaggtcgcacccggcgac
agtgatgtgatcgtgccgctgactggtatccgtaaggtcatcgccgacaagcttgctcgc
agccggcgcgagattcccgaggtgacgatctgggtggacgccgacgcgaccgccctgctg
gagacccgtgcggcgatcaacgcggccaccccgggcgaaccggtgagcatcctggcgttg
ttcgcccggatctgcctgtccgggctgcggaagttccccgagctcaatgcccgggtggac
agcgcggcgcagcgcatcgtccagtctgccggggtgcatctgggcatcgccgcccagacc
gaccggggtctcgtggttccggtcctgcgggacgcgcagcggctcaccaccgccgggctg
gccgccgcgctggccgagaccacggcggcggcgcgggccggcacgctgccccccacccgg
ctcaccggggggacgttcaccctgaacaactacggcgtgttcggggtggacgggtcgacg
ccgatcatcaaccatcccgaggcggcgctgctcggcgtcgggcggatcgtggacaagccg
tgggtggtcgacgggcagctcgcggtgcggaaggtgacgcagatcagcctcaccttcgac
catcgggtctgtgacggaggggtggccggtggcttcctgcgacacgtcgcggactgtgtc
gagcggccgccgcttctgatcgcgaacatctga

DBGET integrated database retrieval system