KEGG   Salinispora arenicola: Sare_2325Help
Entry
Sare_2325         CDS       T00613                                 

Definition
(GenBank) methionine synthase
  KO
K00548  
5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
saq  Salinispora arenicola
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Sare_2325
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Sare_2325
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Sare_2325
Enzymes [BR:saq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Sare_2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2667778..2671293
Genome map
AA seq 1171 aa AA seqDB search
MVISVLDALTDRILVADGAMGTMLHAADLTLDDFDGLEGCNEILNVTRPDAVRSVHEAYL
AVGADCVETNTFGANLPNLAEYGIEGRIRELSEAGARLARTAADAYATPEQPRFVLGSIG
PGTKLPTLGHASYASLRDAYRENAAGLIAGGSDALIIETCQDLLQVKAAVIGSKRAMAEL
GRTVPIICHVAVETTGTMLLGSEIGAALAAIEPLGIDLIGLNCSTGPAEMGEHLRYLSQH
SRIPVSVMPNAGLPVLTSDGAYFPLTPDEMADALERFVTDYGVALVGGCCGSTPEHIRVL
AERLRGRSPVAREPRPEPGASSIYHQVPFAQDASVLMVGERTNANGSKAFREAMLAGDWQ
ACVEIARGQARDGSHLLDLCVDYVGRDGTQDMRELAGRFATASTLPIMLDSTEPGVIEAG
LETLGGRCVVNSVNFEDGDGPDSRYARLMPVVKEHGAAVVALLIDEEGQARTKDWKVRVA
TRLIDDLTGRWGMARSDILIDALTFPIATGQEETRRDGIETIEAIREIAARYPGVNFTLG
ISNVSFGLNPAARQVLNSVFLHECVQAGLTSAIVHASKILPIAKIPSEQREIALDLVYDR
RREGYDPVQRFIETFEGVDAASARASRAEELAALPLNERLKRRIIDGERNGLEADLDAAL
AAGMTALVVINDILLDGMKVVGELFGAGQMQLPFVLQSAEVMKSAVAYLEPHLEKADDGG
KGRIVLATVKGDVHDIGKNLVDIILSNNGYEVVNIGIKQPINAILDAAEQHRADAIGMSG
LLVKSTVIMKENLVEMATRGVAERWPVLLGGAALTRAYVEDDLRSMFPGQVHYARDAFEG
LSLMDRVMAAKRGGAPVVDAEREAALAARRARRERQRAVVSESLPELHDASVRSDVATDV
DLPTPPFFGTRVIKGLPLADYAALLDERATFLGQWGLRGARGGKGPSYEELVETEGRPRL
RYWLDRLAADQVLEAAVVYGYFPAYSDGNDLVVLDENGHAERARFTFPRQRQERRLCLAD
FFRPRGAELDVVALQLVTVGQPISEYTAKLFARNEYRDYLEVHGLSVQLTEALAEYWHRR
IRTELTLPGDRTVAVDDPADLAGLLRNDYRGCRYAFGYPACPDLTDRAKLVELLGAERIG
VHLSEEFQLVPEQATDAIVVHHPEASYFNAK
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatctctgtgctcgacgcgctgaccgaccggatcctcgtcgccgacggggcgatg
ggcacgatgttgcatgcggcagacctgaccctcgacgacttcgacggactggagggctgc
aacgaaatcctcaacgtgactcggccggacgctgttcgcagcgtgcatgaggcatacctg
gccgtgggcgcagactgtgtggaaacaaacacatttggtgctaacctccctaacctcgcc
gaatacggcatcgaggggcgtatccgggagctgtccgaggcgggcgcccggctggcccgc
accgccgccgacgcgtatgcgacgccggagcagcctcgcttcgtcctcggctcgatcggg
ccgggcacgaagctgcccaccctcggacacgcctcgtacgcctcgctgcgggacgcgtac
cgggagaacgccgctggcctgatcgccggtggatcggacgcgctgatcatcgagacctgc
caggacctgctccaggtgaaggcagcggtgatcggctcgaagcgagcgatggccgagctg
ggccgaacggtcccgatcatctgccacgtggcggtggagaccaccggcacgatgctgctg
ggcagcgagatcggcgccgcactggccgcgatcgagccgctcggcatcgacctgatcggg
ctgaactgctccaccggcccggccgagatgggcgagcacctgcgctatctttcgcagcac
tcgcggattccggtgtcggtgatgccgaacgcgggcctgccggtactcacctccgacggt
gcgtacttcccactgacgccggacgagatggccgacgccctggagcggttcgtcaccgac
tatggcgtggcactggtcggcggctgttgcgggagcacgccggagcacatccgggtgctg
gcagagcggctgcgtggccggtcgccggtggcgcgggagccgcggccggagccgggcgcc
tcgtcgatctaccatcaggtgcccttcgcgcaggacgcgagcgtgttgatggtgggggag
cggaccaacgccaacggatccaaggcgttccgtgaggccatgctcgccggggactggcag
gcgtgtgtcgagatcgcccgcggtcaggcacgggacggttcgcatctgttggacctgtgt
gtggactacgtgggccgggatggcacccaggacatgcgcgagctggctggccggttcgct
accgcctccacgttgccgatcatgttggactcgaccgagccgggtgtgatcgaggccggg
ctggagacccttggcggtcggtgtgtggtcaactcggtcaacttcgaggacggcgacggc
ccagactctcggtacgcccgcctgatgcccgtggtgaaggaacacggtgcggcggtggtg
gcgcttctcatcgacgaggaggggcaggcgcgtaccaaggactggaaggtgcgcgtggcc
acgcgattgatcgatgacctgaccggccggtgggggatggcccggtcggacatcctcatc
gacgccctgacctttccgatcgccaccgggcaggaggaaactcggcgggacgggatcgag
accatcgaagcgattcgggagatagccgcccgctacccaggagtcaacttcaccctgggt
atctccaacgtctcgttcggcctcaacccggcggcccggcaggtactcaactcggtgttc
ctgcacgagtgcgtccaggccgggctgacctcggcgatcgtgcacgccagtaagatcctg
ccgatcgcgaagatcccctcggagcaacgggagatcgcgctcgacctggtctacgaccgt
cgccgcgaagggtacgacccggtgcagcgcttcatcgagactttcgagggtgtggacgcc
gcctcggcgcgggccagccgggcggaggaactcgccgccctgccgctgaacgagcggctc
aagcggcggatcatcgacggtgagcgtaacggtctcgaggcggatctggatgcggccctg
gccgccgggatgacggcgctggtcgtcatcaacgacattctgttggacgggatgaaggtg
gtcggtgagctgttcggcgccggtcagatgcagctgccgttcgtgcttcagtccgctgag
gtgatgaagtccgcggtggcatatctggagccgcacctggagaaggccgacgacggcggc
aagggccggatcgtgctcgccaccgtgaagggcgatgtgcacgacatcggcaagaacctg
gtcgacatcatcctgtcgaacaacggctacgaggtggtgaacatcggcatcaagcagccg
atcaacgcgatcctcgacgccgccgagcagcaccgcgcggacgcgatcggcatgtccgga
ctcctggtgaagagtacggtcatcatgaaggagaacctggtcgagatggccacgcgtggt
gtcgcggagcgctggccggtgctgctcgggggtgcggcactgactcgcgcgtatgtcgag
gacgacctgcggtcgatgttccctggccaggtgcactacgcacgggatgcgtttgagggg
ctgtccctgatggatcgggtgatggccgccaaacgcggtggcgcaccggtggtggatgcg
gaacgggaggcggccctggccgcccggcgggcccgccgggagcggcagcgggcggtcgtc
agtgagtcgttgccggagctgcacgacgcatcggtccgctccgacgtggccaccgatgtg
gacctacccaccccgccgttcttcggcacccgggtcatcaaggggctgccgctcgccgac
tacgcggcgttgctcgacgagcgggcgacgttcctcgggcagtggggactgcgcggtgcc
cggggcggtaagggcccgtcgtatgaggaactggtggagaccgagggccggccgcggctg
cgctactggctggaccggctcgccgctgaccaggtactcgaggcagctgtcgtgtacggc
tacttcccggcctactcggacggcaacgacctggtcgtgctcgacgagaacggccatgcc
gagcgggcccgcttcaccttcccgcggcagcgccaggagcggcggctctgcttggctgac
tttttccgcccccgtggtgccgaactggatgtggtggcactgcaactggtcaccgtcggc
caaccgatcagcgaatacacggcgaagttgttcgcccgcaacgagtaccgagactatctg
gaggtccacgggctgtcggttcagctcaccgaggcccttgccgagtactggcaccggcgg
atccgcaccgagctgacgctgcctggcgatcgtacggtggccgtggacgatccggccgat
ctggctgggctactgcgcaacgactaccggggctgccggtatgcgttcggctacccggcc
tgtcccgacctgacggaccgggcgaagctcgtggaactgctgggggcggaacggatcggc
gtgcacctgtcggaggagtttcagctcgtcccggagcaggcaaccgacgcgattgtcgtg
caccatccggaggcgagttacttcaatgccaagtga

DBGET integrated database retrieval system