KEGG   Salinispora arenicola: Sare_2327Help
Entry
Sare_2327         CDS       T00613                                 

Definition
(GenBank) Cytochrome P450-like protein
  KO
K20080  
cytochrome P450 StaN [EC:1.14.-.-]
Organism
saq  Salinispora arenicola
Pathway
Staurosporine biosynthesis
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    Sare_2327
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     Sare_2327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2675731..2676957)
Genome map
AA seq 408 aa AA seqDB search
MSTTTNTELTEAPETNMPVDPGLFDCMPDLIAAARVAPVVRIPYLGRHAWVVCDRELVKQ
ALTHPKMGKDIALVPEWMRQPGLMVTAQPDPEYARAMIMSDGENHARIRRIHAPVLSPRN
TERWGERVADKVEGFLDELSQAGSGGSAEVNVVTNYTHKIPLAFISEMLGLPPEAEHRLR
GITDIMLYSSDYAARREAIGGLFGAVEDWVRNPADLRDGVITGLLAASDGPDAAVTEGEV
IVWTLGMIITGYETTGSLISTSLYEAIRRPPHERPKTDEDITAWIEETLRVHPPFPHPTW
RFPLEDIELGGYLIPKGAPVQVSIAAANRKPGEGADSFDAERRGHGHLSFGLGMHYCIGA
PLVRLEAQIAVRGFLRRFPQARLSAETAVQWESEWMIRRMSVLPAVLS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccaccacgaacaccgaattgaccgaagccccggagacgaacatgccggtcgac
ccagggctgttcgactgcatgccggatctgatcgcggccgcccgggtcgcgccggtcgta
cgaattccctacctgggtaggcatgcgtgggtcgtgtgcgaccgcgagctggtgaagcag
gcgctcacgcaccccaagatgggaaaggacatcgcccttgtcccagagtggatgcgccag
ccgggactgatggtgacagcacagccggacccggagtacgcacgggcgatgatcatgagt
gacggtgagaaccacgcccggatccgacggatccacgcgccggtactgagcccacgtaac
accgagcgatggggcgagcgggtcgccgacaaggtcgagggattcctcgacgagctcagc
caggcgggttcaggcggcagcgccgaggtcaacgtggtcacgaactacacccacaagatc
ccgctggcgttcatctccgagatgctcggcctgcccccggaggcggagcaccggctacgc
ggcatcactgacatcatgctgtactcatccgactacgctgcccgccgggaggcgatcgga
gggctgttcggggcggtcgaggactgggtgcgcaacccggccgacctgcgcgacggtgtg
atcaccgggctactggccgcctctgatgggccggatgccgcggtcaccgagggcgaggtc
atcgtctggaccctaggcatgatcatcacgggctacgaaaccacggggagtctgatctcc
acttcgctgtacgaggccatccgccgaccaccgcacgagcgaccgaaaactgacgaggac
atcacggcttggatcgaggaaaccctgcgggtgcacccgccgtttccgcacccgacctgg
cgctttcccctggaggacattgagcttggcggctacctgatccccaagggtgcccccgtg
caggtcagcatcgcggcggcgaatcggaagccgggcgagggtgccgacagcttcgatgcg
gagcgacgggggcacggccacctgtccttcgggctcggcatgcactactgcatcggcgcc
ccactggtccggctcgaggcgcagattgcggtgcgtggcttcctgcgacggttcccgcag
gcccggttgagcgccgagaccgccgtccagtgggagtcagagtggatgatccgccggatg
agcgtcctgcccgccgtgctctcctga

DBGET integrated database retrieval system