KEGG   Salinispora arenicola: Sare_2331Help
Entry
Sare_2331         CDS       T00613                                 

Definition
(GenBank) cytochrome P450
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2683326..2684579
Genome map
AA seq 417 aa AA seqDB search
MPSATLPRFALTGWSRENIVNPYPVYQRYREVASVHRGEPGGDAPDTFYVFSYDEVVQVL
SSNCFGRGRSLDAAKASVPVPAEQKALRAIVENWLVFMDPPRHTELRSLLNRSFSPRIVT
ELRPRIARIAQELLSRLGQQVDVDLVESFAAPLPILVISELLGIPEERRAWLRANALALQ
EASSSRAGRDVDGYAQAEVAAQEFTEYFREQVRLRRGRAGGDLITILANAQERGAPVSLD
AIVGTCVHLLTAGHETTTNSLAKAVLALREHPAVLDELRGAEGLTTDAVEEFLRYDPPVQ
AVTRWAHQDTTLGGCDIPRGSRVVALLGSANRDPARFPSPDVLDVRRPADRHLSFGLGIH
YCLGATLARAELEIGLQALLDGVPTLGYGTQHVDYADDLVFHGPSRLVLVNLGERCK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgccatccgcgacgttgccgcggttcgccctgaccggctggagcagggagaacatcgtc
aatccctacccggtgtaccagcgctaccgggaggtcgcttcggtgcaccggggcgaacca
ggcggcgacgccccggacaccttctacgtgttctcctacgacgaggttgtccaggtgctg
tcgagtaactgtttcggtagggggaggtccctcgacgccgcgaaggcatcggtcccggta
ccggccgagcagaaggccctccgggcaatcgtcgagaactggctggtgttcatggacccg
ccacgccacaccgaactacgctcgctactcaaccggagcttttctccccggatcgtgacc
gaactgcggccccgcatcgcgcggatcgcacaggaactcctgtcccggctcggccagcag
gtggacgtcgatctcgtcgagagcttcgccgcgccgttgcccatccttgtcatctccgag
ctgctggggattccggaggagcgtcgcgcatggttgcgtgccaacgcgttggcgctgcag
gaagccagttcctcccgtgcgggtcgggacgtggatggctacgcacaggccgaagtggcc
gcgcaggagttcaccgagtacttccgggagcaggtgcggctacggcggggtcgtgccggt
ggagatctgatcacgatcctcgccaacgcacaggagcgcggtgcaccagtgagtctggac
gcgatcgtggggacctgcgtccacctcctgaccgccgggcacgagaccaccaccaattcg
ctggcgaaggccgtgcttgcgctgcgggaacatccggcggtactcgacgagctccgcggc
gccgaggggctgacgacggatgcggtcgaggagttcctgcgctatgacccgcccgtgcag
gccgtgacccgatgggcgcaccaggacaccaccctcggcgggtgtgacataccacgcggc
agccgagtggtcgcgctgctgggctcggcgaatcgggatccggcacgcttcccgtcacct
gatgtcctggacgtacgtcgccctgccgaccggcacctcagtttcggtctgggtatccac
tactgcctcggcgcgacgctggcccgcgccgagctcgagatcgggctccaggcactgctg
gacggtgttcccacgctgggctacggcacccagcacgtcgactacgccgacgacctggtc
ttccacggaccgagccggctggtactcgtcaacctaggagaaaggtgtaaataa

DBGET integrated database retrieval system