KEGG   Salinispora arenicola: Sare_2332Help
Entry
Sare_2332         CDS       T00613                                 

Definition
(GenBank) Methyltransferase type 11
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2684579..2685418
Genome map
AA seq 279 aa AA seqDB search
MSKVSSQPVPKAVGELYDRLTLSAMTDGTFNPNVHIGYWDSPESTASVDEAMDRLTDVFI
ERLKVGASNHVLDLGCGVGGPGLRVVAQTGARVTGISISEEQVKSANRLAAEAGVADRAV
FQHGDAMRLPFPDHSFDAVMALESMCHMPDRQQVLTEVCRVLVPGGRLVLTDVFERFPRK
EVRHQGIDKFCNDLMSTTADLDDYVAMLHRSGLRMRELLDVTEQTTLRLAYELAKLPVLQ
ERPAALNEGNFEFSDDAFKPSDLEGVDDFGCLLATAERP
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagtgtcatctcagcccgtaccgaaagcggtcggcgagctgtacgaccgtctc
accctgagcgcaatgaccgacggtacgttcaacccgaacgtacacattggatactgggac
tcgccggagtcgacggcgtcggtcgacgaggcgatggaccggctgaccgacgtgttcatc
gagcgtttgaaggtcggcgcgtcgaaccacgttctcgatctgggctgcggggttggcggg
cccggcctgcgagtggtggcgcaaaccggcgcacgtgtcacgggcatcagcatcagcgag
gagcaggtcaaaagcgccaaccggctagcggccgaggcgggagtcgccgaccgcgccgtg
ttccagcacggcgacgcgatgcgactcccgttcccggaccattcgttcgacgcggtgatg
gctctggagtcgatgtgccacatgccggaccggcagcaggtgctcaccgaagtgtgccgg
gtgctcgtcccgggtggccggctcgttctgacggacgtgttcgagcgcttcccgcgtaag
gaagtccggcaccagggcattgacaagttctgcaacgatctcatgtccaccacggcggac
ctcgacgactacgtcgccatgctgcaccgttccggtctgcggatgcgcgagctgctcgac
gtgaccgaacagaccacgctgcgcctggcgtacgagttggccaaactgcccgtcctccag
gaacgccccgcggccctgaacgaaggcaacttcgagttctccgacgacgctttcaaaccg
tccgacctggaaggcgttgacgacttcggctgcctcctggcaacggcggaacgcccgtag

DBGET integrated database retrieval system