KEGG   Salinispora arenicola: Sare_2339Help
Entry
Sare_2339         CDS       T00613                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2691098..2692102
Genome map
AA seq 334 aa AA seqDB search
MAVKRPLVVLLGATGFVGSAVLRELAVRDVRVRAVSRGAASVPEDARAEIEVHTADLTEP
GRLAQAIAGADVVIHTIAYIAGSTTWRINEGDSAAERVNVGLVRDLVAVLRDGDRNLPPL
PVVFAGAVSQVGPTDKEVLDGSEPDWPQGEYDRQKLAAERVLLDAHAERILRAVSIRLPT
VFGYGPRSTARDKGVVSTMVRRALAGEPITMWHDGTVRRDLLYVEDVARALVAAVDHVDA
LAGRPWLLGSGRGLPLGEVFTTVASLVAERTGKPPVRVVSVPPPEHAEPGDFHNITIDAT
PFRSVSGWRPKVPLTDALRHTVDFCASGAEEGLS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgaagcgtcccctcgttgtgctgctcggtgcgaccggcttcgtcggctccgcc
gtgctacgcgagctcgccgtgcgtgacgttcgggtgcgggccgtctcgcgcggcgcggcc
tcggtccccgaggacgcccgcgccgagatcgaggtgcacaccgccgacctcaccgagcct
ggccgcctggcccaggccattgccggtgccgacgtcgtcatccacaccatcgcctacatc
gccggctcgacgacctggcgtatcaacgaaggtgactcggctgccgagcgcgtcaatgtc
ggtctggtccgcgacctggtcgcggtgctgcgggacggcgaccggaacctcccgcccctg
cccgtggtcttcgcgggcgccgtctcgcaggtcgggcccactgacaaggaggtgctcgac
ggcagcgagcccgactggccccagggcgagtacgaccggcagaagctcgccgccgaacgg
gtgctgctcgacgcgcacgcggagaggatcctgcgagctgtgtcgatccggcttcccacg
gtgttcgggtacggcccacgttccaccgcccgggacaagggtgtggtgtccaccatggtg
cgtcgggccctggccggggaaccgatcaccatgtggcacgacggtacggtgcgccgggac
ctgctctacgtcgaggacgtggcgcgggcgcttgtcgcggcggtcgaccacgttgacgcc
ctggccgggcggccgtggctactcggatccgggcgtgggctgcccctgggcgaggtgttc
accacggtggcgagtctggtcgccgaacgtaccggcaagccgcctgtgcgggtcgtctcg
gtgcccccacccgagcacgccgagccaggtgacttccacaacatcacgatcgacgcgacc
ccgttccggtcggtcagcggctggcgcccgaaggtaccgctgaccgatgcgctgcgtcac
acggtcgacttctgtgccagtggtgccgaggagggcctgtcgtga

DBGET integrated database retrieval system