KEGG   Salinispora arenicola: Sare_2340Help
Entry
Sare_2340         CDS       T00613                                 

Definition
(GenBank) NDP-hexose 23-dehydratase
  KO
K16435  
dTDP-4-dehydro-6-deoxy-alpha-D-glucopyranose 2,3-dehydratase [EC:4.2.1.159]
Organism
saq  Salinispora arenicola
Pathway
Polyketide sugar unit biosynthesis
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sare_2340
   01055 Biosynthesis of vancomycin group antibiotics
    Sare_2340
Enzymes [BR:saq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.159  dTDP-4-dehydro-6-deoxy-alpha-D-glucopyranose 2,3-dehydratase
     Sare_2340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2692176..2693573
Genome map
AA seq 465 aa AA seqDB search
MTAPTVLRLRADDTLAQRLARSAALRAEGFALRTADVAGWLTQRARAHHFRVERIALNDL
DGWFFATDTGNLHHHTGRFFSIEGIDVNHNEGAIRRWQQPMIRQPEVGILGILAKEFDGV
LHFLLQAKMEPGNRNLLQLSPTVQATHSNYTGAHRGTPVKYLEYFTDPSRGTVLTDVLQS
EHGSWFYRKSNRNIVMETVDDVPVDDDFCWLTLGQIGELLRYDNVVNMDARTVLASCPVT
SAEPGALNTDMELRSWFTVERSRHSLTAERVPLADIEEWKRSDFTLGRDDGRYFRLVAVA
VEAGNREVTGWSQPLFEPTGIGVSAFLFRHFGGVPHLLVQAKVEAGFLDTVELAPTVQCT
PGNWAHLPEPLRPYFLDVVRVAGPDRVRYAAVHSEEGGRFLNAESRYLFVEADEAQAPLD
PPTGFRWATPGQLNNLAQHGHYLNVQARTLLACLNAGTVRLDPTR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccgaccgtgctgcgcctacgcgccgacgacacgctggcccaacggttggct
cgctcggcggccctgcgggccgagggcttcgcgctgcgtacggccgacgtcgccggatgg
ctcacccagcgggctcgggcgcaccacttccgagttgagcggattgcgctgaacgatctg
gatgggtggttcttcgcgactgataccggcaacctgcaccaccacaccggccggttcttc
tcaatcgagggtatcgacgtcaatcacaacgagggggcaattcgccggtggcagcagccg
atgatccgccagcctgaggtgggcatcctgggtattctggccaaggagttcgacggtgtg
ctgcacttcctcctccaggcgaagatggaacccggcaaccgcaatctcctgcagttgtca
ccgacggttcaggccacccacagtaactacaccggcgcgcaccgggggacgccggtgaag
tacctggagtacttcaccgatcccagccgcgggactgttctgaccgacgtcctccagtcg
gagcacggttcctggttctatcggaagtccaaccgcaacatcgtgatggagacggtggac
gacgtgccggtggatgacgacttctgctggctgactctcgggcagatcggtgagctgctg
cggtacgacaacgtcgtcaacatggacgcccggacggtcctggccagttgtccggtgacc
tcggccgagcctggcgccctgaataccgacatggagctacggtcctggttcactgtcgaa
cggtcccgccacagcctgaccgccgagcgggttccgctggccgacatcgaagagtggaag
cgtagcgacttcactctcggccgggatgacggccgctatttccgtctggtcgccgtcgcg
gttgaggcgggcaaccgtgaggtcaccggctggtcgcagccgctgttcgagccgacgggc
atcggtgtgagcgccttcctgttccgtcatttcgggggcgtaccgcacctgttggtgcag
gcgaaggtggaggccgggttcctggacaccgtcgaactggcaccgacggtgcagtgcacg
ccgggtaactgggcgcacctgccggagccgctgcgcccgtacttcctcgatgtcgtccgg
gtcgcgggccccgaccgtgtgcgctacgcggcggtgcactccgaggagggcggcaggttc
ctcaacgccgagagccggtacctgttcgtcgaggccgacgaggcgcaggcgcccctcgac
ccgcccaccgggtttcgctgggcaaccccggggcagctcaacaatctggcccagcacggc
cactacctcaacgtccaggcccgcaccctgctcgcctgcctcaacgccggtacggtgcgt
ctggatccgaccaggtga

DBGET integrated database retrieval system