KEGG   Salinispora arenicola: Sare_2344Help
Entry
Sare_2344         CDS       T00613                                 

Definition
(GenBank) Domain of unknown function DUF1801
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2698675..2699157
Genome map
AA seq 160 aa AA seqDB search
MRATSKASKKGAQPESTEEGLSEAERTAVKDRAAELRSESRRSRSTNKAAADERDVLAKI
SAMAQPDRALAERLHALVAATAPELAPKLWYGQPAYARNGKVVCFFRSGQGDKQRYSTFG
FTPEARLDEDHGLWATSFALTELSEQAEAAIERLLRSAVS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgagggctacgtcgaaggccagcaagaagggcgcacagcccgaatccactgaggaagga
ctctctgaggccgagcgcaccgccgtcaaggaccgtgcggcggagttgaggtcggagtcg
cgtcgaagcaggagcacgaacaaggcggcggccgacgagcgggacgtgttggcgaagatc
agcgctatggcccagcccgaccgggccttggctgaacgcctgcacgccctcgtcgcggcg
accgctcccgaactggcgccgaagctgtggtacggccagcccgcctacgcccggaatgga
aaggtggtgtgcttcttccgcagtggccagggggacaaacagcgctactcgacgttcggt
ttcacaccggaggcaaggttggacgaggaccacggcctgtgggcgacgtcattcgccctg
acggagctgagtgagcaggccgaggcggcgatcgagaggctactcaggagcgccgtgagc
tga

DBGET integrated database retrieval system