KEGG   Salinispora arenicola: Sare_2346Help
Entry
Sare_2346         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2699769..2700503)
Genome map
AA seq 244 aa AA seqDB search
MTTKVGVFLHSRHLETEAWEDLVLGLPMDDRFGDMATLAREVLTLGQDHELTCIVIGGGS
SHRDGISEGEYTKRYLLANLARLEEFPRLKPLLDRLSGPQRAAFGRAVHDIIITPQVRNT
VAEIEAAAGIFAAHRVDRVLQIAAASHAPRCLKEQSVARSHGRIAREQQWYAVATEMTYG
DTQPEDVCVIEPLHRRDQPMTFVRPGFSEVIAPYFFLPDADKKALVATIAEFMAARDGAA
RLPR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccaaggtgggcgtgttcctgcacagccgtcacctcgagacggaggcgtgggag
gacctggtcctcggcctacccatggacgacaggttcggcgacatggccacgttggctcgg
gaggtcctgaccctcggccaggatcacgagctcacctgcatcgtcatcgggggtggctcc
tcccaccgcgacggcatcagcgagggcgagtacacgaagcggtacctcctcgcgaacctc
gcccggctggaggagttccctcggctgaaaccactgcttgaccgactgtccggcccacag
cgggcggcgttcggccgagccgtacacgacatcatcatcacgccacaggtccgtaacaca
gttgcggagatcgaggctgcggctggcatcttcgccgcgcaccgcgtagaccgggtactg
cagatcgccgccgccagccatgcaccccgctgcctcaaggagcagtccgttgcccggtcg
cacggccggatcgcgcgagaacagcagtggtacgccgtcgccaccgagatgacctacggt
gacacccaacccgaggatgtctgcgtcatcgagccgctacaccggcgcgaccagccgatg
accttcgtgcggccagggttctccgaggtcatcgcgccgtacttcttcctgccggatgcc
gacaagaaggccctggtggcgacgatcgcggagttcatggccgcccgggacggcgccgcc
cggctgccgaggtga

DBGET integrated database retrieval system