KEGG   Salinispora arenicola: Sare_2349Help
Entry
Sare_2349         CDS       T00613                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 3
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2702827..2703474
Genome map
AA seq 215 aa AA seqDB search
MLFDMDGTLVDSEKLWEVALHELAVAYGGALSEPARRAIVGTSMAVSMRILHDDLGQPER
DPHASAAWINTRILELFRSGLRWRPGALALLQAVRAAGIPTALVTSSGRTLVEVALDTLG
RDSFDAVVCGDEVEAAKPHPTPYLTAARLLGVPIGRCVAIEDSPTGVASALAAGAAVLAV
PTEVPVEPSAGVHQLASLTAADLELLAALLGKPPA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgctcttcgacatggacggcaccctggtggacagcgagaagttgtgggaggtcgcgctg
cacgagctggcagtcgcctatgggggcgcactctcggagcccgcccgtcgggcgatagtc
ggcacgagcatggcggtctcgatgcggatcctgcatgacgacctgggccagccggaacgc
gacccgcacgccagcgccgcgtggatcaacacgcggattctggagctgttccgcagcggg
ctgcggtggcggcccggcgcactggccctactgcaggccgtccgggccgcgggtatcccg
acggccctggtcacctccagcggacggacgctggtggaggtggcactcgacaccctgggc
cgggacagcttcgatgcggtggtgtgcggggacgaggtggaggcggccaagccgcatccg
acgccctacctgaccgctgcccggctgctcggtgtgccgatcggccggtgtgtggcgatc
gaggactccccgaccggggtggcaagcgccctggccgccggcgcggcggtcctcgcggtg
ccgacggaggtgccggtggagccatccgccggcgtgcaccagctggccagcctgaccgcg
gcggacctggagctactcgcggcgctgctcggcaaaccgccagcctga

DBGET integrated database retrieval system