KEGG   Salinispora arenicola: Sare_2350Help
Entry
Sare_2350         CDS       T00613                                 

Definition
(GenBank) protein of unknown function DUF214
  KO
K02004  putative ABC transport system permease protein
Organism
saq  Salinispora arenicola
Module
saq_M00258  Putative ABC transport system
Brite
Transporters [BR:saq02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    Sare_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MacB_PCD FtsX
Motif
Other DBs
NCBI-ProteinID: ABV98208
JGI: Sare2350
UniProt: A8M292
Position
complement(2703567..2706116)
Genome map
AA seq 849 aa AA seqDB search
MFRATLKSLLARKLRLILSGLAVVLGVMFVSGAFVLTDTLGRSFDAAFADAYEGVDVNVA
AKPKVELSDFEGGQVLAPVPAAELERVRAVDGVADATGVVAADGARLIGSNGKVVTTFGP
PQLGENWVGVSDLVQLREGREPQADDEIVVNAGLAKAGRVAVGDQVGVLTLEPKQEFTIV
GVFGYSGDRDSIGGVNEIMFTTPVAQQLMLGQRDVFTNITVAAADGVSNDRLRDDIAAVL
GADFEVKTGAQLSADASAGLKEGLSFFNRILLGFAAVALLVGTFLILNTFSIIVAQRTRE
LALMRAVGAGRRQIIGSVVLEAVAVGLLASVLGLGAGVGVGALLAYVFGSITGGLDLAGI
AVPPAAVIGAFGVGLVITVVAALLPALRAARIPPIAAMQDVATPDRPLTKVTVAGAAVTS
IGATLLFLGLGGHTGDGSLMTILGGVLFAFIGVALLTPLVSRPVVGLLGGLFSWWMPGKL
GRLNSGRNPRRTAITAAALMVGIALVTGVTVILDSAKSSISGLAQDRIKAELVIAGAQTG
ARPPSFDSAVLAESAAIPGVALVGGVYGDLAQVGDERTWVGANSDVSTLAKIFGAKATAG
DISRLGPDQMLVSSDVAAARGLSVGSTVPVQLARADAKTYTVSGIYESDEFLDPVTLPVE
AAQGFTIPQPITGFIQLGPGTQADDVLPRVEALLADSPEVSVADRDAFIQQQTSQLDGLL
QMIQILLLLAIVIAVLGIINTLALSVLERTRELGLLRAVGLGRGQTMGMITVEAVVISVF
GALLGITVGSGLGAAVVEALHDEGITDLVLPWADMGVMVGLGAFVGVLAAVIPAVRAARI
DVLGAIAHD
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgttccgggcgaccctcaagagcctgctggcgcgcaagctcaggctgatcctgtccggg
ttggcggtggtgctcggcgtcatgttcgtctcgggcgcgttcgtgctcaccgacaccctc
ggcaggtccttcgacgcggccttcgccgacgcgtacgagggggtggacgtcaacgtcgcc
gcgaagccgaaggtggagttgagcgacttcgagggcgggcaggtgctggcaccggtgccg
gccgcggagctggagcgggtccgagccgtcgatggggtggccgacgccacgggcgtcgtg
gccgccgacggcgcccgcctgatcggcagcaacggcaaggtggtcaccaccttcggaccg
ccccaactcggtgagaactgggtgggcgtgagtgatctcgtgcagctgcgcgagggccgg
gaaccgcaggcggacgacgagatcgtcgtcaacgccggcctggccaaggccggtcgggtc
gccgtcggcgaccaggtgggcgtgctcacgctcgagccgaagcaggagttcaccatcgtc
ggggtcttcggctacagcggagaccgcgactccatcggcggggtcaacgagatcatgttc
accaccccggtggcacagcagttgatgctcggccagcgcgacgtcttcaccaacatcacg
gtcgccgccgccgacggcgtgtcgaacgatcggctgcgcgacgacatcgccgccgtgctc
ggggccgacttcgaggtgaagaccggggcacaactctccgccgacgcatcggcgggtctg
aaggaggggctgtccttcttcaaccgaatcctgctcggcttcgccgcggtggcgctcctg
gtgggcacgttcctgatcctcaacaccttttcgatcatcgtggcccaacgcacgcgggaa
ctggcgctgatgcgcgccgtcggggcgggccgccgccagatcatcggctcggtggtactg
gaggcggtggcggtcggcctgctcgcctccgtgctcggcctcggcgccggcgtcggtgtc
ggcgcgttgttggcgtacgtgttcggcagcatcaccggtgggctggacctggcggggatc
gcggtaccaccggcggcggtgatcggagcgttcggtgtcggtctggtcatcacggtggtg
gcggcgctgctacccgcgctgcgggcggcacggattccgccgatcgccgcgatgcaggac
gtcgcgacgccggaccggccgctgaccaaggtcacggttgctggcgcggcggtgacctcg
atcggtgccaccctgttgttcctggggctcggcgggcacaccggcgacggctccctgatg
acgatcctcggcggggtgctgttcgccttcatcggggtggcgctgctgaccccactggtc
agccggccggtggtcggtctgctcggcgggcttttctcctggtggatgcccggcaagctg
ggccggctcaactccgggcgcaacccgcgccgtacggcgatcacggcggcggcgctgatg
gtcggtatcgccctggtcaccggtgtcaccgtcatcctggactcggccaagagcagcatc
agtggcctggcccaggacaggatcaaggccgagttggtgatcgccggtgcgcagaccggc
gctcggccgccgagcttcgactcggcggtgctggcggagtccgcggcgatccccggggtg
gcgctggtcggtggcgtctacggtgacctggcccaggtcggcgatgagcgcacctgggta
ggtgccaacagcgacgtgtcgacactggcgaagatcttcggcgcgaaggccactgccggg
gacatcagccgactcgggccggaccagatgctggtcagttcagacgtggcggccgcacgc
gggctgtccgtcggctccaccgtgccggtgcagttggctcgcgccgatgcgaagacctac
acggtcagcggcatctacgaaagcgacgagttcctcgacccggtcaccctgccggtggag
gcggcgcagggcttcaccatcccccagccgatcacgggcttcatccagctcgggcccggc
acccaggcggacgacgtactgccgcgggtggaggcgctcctggcggacagcccggaagtg
tccgtggccgaccgggacgcgttcattcagcagcagaccagccagctcgacggcctgctc
cagatgatccagatcctgctgctgttggccatcgtgatcgcggtgctcggcatcatcaac
acactcgccctgtccgtgctcgaacgcacccgggaactggggttgctgcgggcggtcggg
ctgggccgcgggcagaccatgggcatgatcaccgtagaggccgtggtgatctcggtgttt
ggcgcgctgctcggcatcaccgtcggctccggcctcggtgcggccgtcgtcgaggcgttg
cacgacgaggggatcaccgacctggtgttgccctgggcggacatgggggtgatggtcggt
ctcggcgcgttcgtcggcgtcctcgccgccgtgatcccggcggtccgtgccgcccgcatc
gacgtcctgggcgccatcgcccacgactga

DBGET integrated database retrieval system