KEGG   Salinispora arenicola: Sare_2351Help
Entry
Sare_2351         CDS       T00613                                 

Definition
(GenBank) ABC transporter related
  KO
K02003  
putative ABC transport system ATP-binding protein
Organism
saq  Salinispora arenicola
Module
Putative ABC transport system
Brite
Transporters [BR:saq02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    Sare_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2706116..2706883)
Genome map
AA seq 255 aa AA seqDB search
MTATVGRQAQAAARASEVWKVYGSGEAQVVALRGVTCEFEQGRFTAIMGPSGSGKSTLMH
CLAGLDSVTRGTVSIGDTTVTGLGDAGLTKLRREQVGFIFQQFNLLPTLTAKENILLPLS
IAGRKPDPAWYDMVIDTVGLRERLDHRPAQLSGGQQQRVACARALVSRPQVIFADEPTGN
LDSRAGAEVLKFLRNSVREHGQTIVMVTHDPTAAAYADRVVFLADGQIVSELIEPTAETV
LDTMKKLDAQVEVDD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgacggtaggccgtcaggcgcaggccgcggcccgcgcgagcgaggtgtggaag
gtgtacggcagcggggaggcacaggtagtcgcgctacgcggggtcacctgcgaattcgaa
caaggccggttcaccgcgatcatgggtccgtccgggtcgggcaagtcgactttgatgcac
tgcctcgccgggctggactcggtgacccggggcacggtgtcgatcggcgacaccacggtc
accggtctgggggacgccggtctgaccaagctacgccgcgaacaggtcggtttcatcttc
caacagttcaacctgctgccgacgttgaccgcgaaggagaacatcctgctgccgctgtcg
atcgccgggcggaagccggacccagcctggtacgacatggtgatcgacactgtcggcttg
cgggaacggctggatcaccggccggcacagctgtccggtgggcaacaacagcgggtggcg
tgcgcccgggcgctggtcagtcgcccacaggtgatcttcgctgacgagccgacgggcaac
ctcgactcacgggccggtgcggaggtgctgaagttcctgcgcaactcggtgcgcgagcac
ggccagaccattgtcatggtcacccacgacccgaccgccgccgcgtacgccgatcgggtg
gtcttcctcgccgacgggcagatcgtctccgagctgatcgagccgacggcggagacggtg
ctggacacgatgaagaagctcgacgcccaggtcgaggtggacgactga

DBGET integrated database retrieval system