KEGG   Salinispora arenicola: Sare_2353Help
Entry
Sare_2353         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07465  
putative RecB family exonuclease
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2707942..2708853)
Genome map
AA seq 303 aa AA seqDB search
MTADPVTTQQLPPTAEVPATLRASLSPSRAADFKTCPLLYRFRSIDRLPEQPSVEQARGT
LVHAVLERLFDLPPAGRTPTAAGDLVAPQWERLVAEQPELAALFAADAEARAEFLRSATG
LLRGYFAVEDPRRLEPAERESLISAVVDEELLIRGYLDRLDVAPDGALRVVDYKTGGAPR
EAFEARALFQLKFYALVLWRTRGVVPRVLRLLYLKDAEVCDYAPDADELVRFERTVVALW
RAIEAATAAQDFRPRPSRLCDWCSHQRLCPSFGGTPPPFPVGSAPADPLPDARSRPTPPG
ADE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacagcggatccggtgacgacccagcagctcccgcccacggcggaggtgcctgcgacg
ctacgggcttcgctgtccccctcgcgggcggccgacttcaagacctgcccgttgctctac
cggttccgcagcatcgaccggctacccgagcagcccagtgtggagcaggcgcggggcacc
ctggtccacgccgtgctggaacggctgttcgacctgcctcccgccgggcgcacgccgacc
gccgccggtgacctggtggctccgcagtgggaacggctggttgccgagcagccggagctg
gctgccctgttcgccgccgacgctgaggcccgcgcggagtttctgcgttcggccacgggg
ctgctacgcggctacttcgcggtggaggacccacgccgcctggagccggccgagcgggag
agtctcatctccgcggtggtcgacgaggagctgctgatccggggctacctggaccggctg
gacgtggccccggacggcgcgctgcgggtggtcgactacaagactggcggcgcacctcgg
gaggcattcgaggcgcgggcgctgttccagctcaagttctacgcgttggtgttgtggcgt
acccgcggggtggtgccacgcgtgctccggctgctctacctgaaggacgcggaggtctgc
gactacgctccggacgctgacgaactggtgcggttcgagcgcacagtggtggccctgtgg
cgggcgatcgaggcggccaccgccgcccaggactttcgcccgcggccaagccggctgtgt
gactggtgcagccaccagaggctgtgtccgagcttcgggggcacgccgccgccgttcccg
gtcgggtcggctccggccgacccgctgccggacgcgcggtcccgcccgacacccccgggc
gctgacgagtga

DBGET integrated database retrieval system