KEGG   Salinispora arenicola: Sare_2355Help
Entry
Sare_2355         CDS       T00613                                 

Definition
(GenBank) tRNA methyltransferase complex GCD14 subunit
  KO
K07442  
tRNA (adenine57-N1/adenine58-N1)-methyltransferase catalytic subunit [EC:2.1.1.219 2.1.1.220]
Organism
saq  Salinispora arenicola
Brite
Enzymes [BR:saq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.219  tRNA (adenine57-N1/adenine58-N1)-methyltransferase
     Sare_2355
    2.1.1.220  tRNA (adenine58-N1)-methyltransferase
     Sare_2355
Transfer RNA biogenesis [BR:saq03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    Sare_2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2710094..2711074
Genome map
AA seq 326 aa AA seqDB search
MTAPPSAAPDQYVPAPPPVRRGPFQPGDRVQLTDPKGRMHTITLEPGKEFHTHRGILHHD
ALIGRPDGSVVTTAGGGTAFLALRPLLADYVLSMPRGAQVIYPKDSAQIVAMGDVFPGAK
VLEAGVGSGALSCSLLRAVGPSGQLHSWELRDDFAQIARRNVEAFFGGPHPAWQLRVGDV
AANSATGFDRIILDMLSPWEALDMVERALLPGGVLVGYVATTPQLSDLVEALRERGGWTE
PRAWESMVRDWHAEGLAVRPDHRMIAHTAFLVSARKLAPGVTAPPRRRKPSKGMEAYAQR
RAALREAAATPVGSVEPGLAEEERRP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcacctccctccgccgcgcccgaccagtacgtccccgcaccgcctccggtgcgc
cgcgggccgttccaacccggtgaccgggtgcagttgaccgacccgaaggggcggatgcac
acgatcaccctggagccgggcaaggagttccacacgcaccgcggcatcctgcaccacgac
gctctgatcggccgacccgacggcagtgtcgtcaccaccgctggcggcgggacggcgttc
ctcgccctgcggccgttgctcgccgactacgtgttgtcgatgccccgcggtgctcaagtg
atctatccgaaggattctgcccagatcgtcgccatgggcgatgtttttcccggtgccaag
gtccttgaggccggtgtcggatccggcgcgctgagctgctccctgctgcgtgccgtcggc
ccgtccgggcagctgcactcgtgggagctgcgtgacgacttcgcccagatcgctcgacgt
aacgtcgaggcgttcttcggcggcccgcaccccgcatggcagctgcgggtcggtgacgtg
gcggcgaactcggcgaccgggttcgaccgaatcatcttggacatgctcagcccgtgggag
gcgctcgacatggtcgagcgggcactgctgcccggcggcgtgctggtcgggtatgtcgcc
accaccccgcagttgtccgacctggtggaggcgttgcgggaacgcggtggctggacggag
ccgcgggcctgggagtcaatggtccgcgactggcacgccgaggggttggccgttcggccc
gaccatcgcatgatcgcccacaccgcgttcctggtgtccgcgcgtaagctcgcccctggg
gtcaccgccccgccccggcgtcgcaagcccagcaagggtatggaggcatacgcgcagcgc
cgcgcggccctgcgggaggcggcggccaccccggttggttcggtggagcccggcctggcg
gaggaggaacgacggccatga

DBGET integrated database retrieval system