KEGG   Salinispora arenicola: Sare_2358Help
Entry
Sare_2358         CDS       T00613                                 

Definition
(GenBank) AAA ATPase central domain protein
  KO
K13527  
proteasome-associated ATPase
Organism
saq  Salinispora arenicola
Pathway
Proteasome
Module
Bacterial proteasome
Brite
KEGG Orthology (KO) [BR:saq00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    Sare_2358
Proteasome [BR:saq03051]
 Prokaryotic proteasome
  Bacterial regulatory particles
   Sare_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2712312..2714093
Genome map
AA seq 593 aa AA seqDB search
MARSDDADSRAARWEKEAHDLSTQVAFLQEELALVRRKLTESPRHVRQLEERLAAAQAQL
ARLTENNERLVSTLKEARAQIVTLKEEIDRLAQPPSGYGIFLERHDDGTVDVFTGGRKLR
VAVSPSLDVAELCRGQEVLLNDALNIVDAFGYERAGEVVMLKEVLAGPDGAPGDRALVVS
HSDEERVVHLAETLIGAAIRAGDSLMIEPRSAYAYERIPKSEVEELVLEEVPDVDYTDIG
GLHAQIEQIRDAVELPFLHADLFREHQLRPPKGILLYGPPGCGKTLIAKAVANSLAKKIA
ERRGEEKHTSYFLNIKGPELLNKYVGETERHIRLIFQRAREKAGEGTPVIVFFDEMDSVF
RTRGSGVSSDVENTIVPQLLSEIDGVEGLENVIVIGASNREDMIDPAILRPGRLDVKIKI
ERPDAEAAKDIFSKYILSGLPLHPDDLAEHGGEPQATVAAMIDAVVLRMYSETEENRFLE
VTYANGDKDVLYFKDFNSGAMIQNIVDRGKKMAIKEFLTSARKGLRLQHLLDACVDEFRE
NEDLPNTTNPDDWARISGKKGERIVYIRTLVSGGKGADAGRSIETASNTGQYL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgcagcgacgacgcggactcgcgcgccgcacggtgggagaaggaggcccacgat
ctctccacgcaggtcgcgttcctgcaagaggaactcgctctggtgcggcgcaagttgacc
gaaagcccccgacacgtccggcagctcgaagagcggctggctgccgcccaggcccagttg
gcgcggctgaccgagaacaacgagcggctcgtgagcaccctcaaggaggctcgggcgcag
atcgtgacgctcaaggaggagatcgaccgtctcgcccagccgccgagtggctacgggatc
ttcctggagcggcacgacgacggcacggtggacgtgttcaccggtggccgcaagctccgg
gtggccgtctcaccgtcgctggacgtcgccgagctgtgccgtgggcaggaagtcctgctc
aacgacgcgctcaacatcgttgacgcgttcggctacgagcgggccggtgaggtcgtcatg
ctcaaggaggtgctcgccggaccggacggcgcccccggcgaccgtgccctcgtggtctcc
cactccgacgaggaacgcgtcgtgcacctcgcggagaccctgatcggcgccgcgatccgg
gcgggagactcgctcatgatcgagccccgctcggcgtacgcgtacgagcggattccgaag
agtgaggtcgaggaactggtcctggaggaggtgccggacgtcgactacaccgacatcggc
ggcctccacgcgcagatcgagcagatccgcgacgcggtggagctgccgttcctgcacgct
gatctgttccgcgagcaccagctccggccgccgaagggcatcctgctctacggaccaccc
ggctgtggtaagaccctgatcgccaaggcggtggccaactcgctggcgaagaagatcgcc
gagcggcgcggcgaggagaagcacaccagctacttcctcaacatcaagggtcctgagctg
ctcaacaagtacgtcggcgagaccgagcggcacatccggctgattttccagcgcgcgcgg
gagaaggccggtgagggcacgccggtcatcgtgttcttcgacgagatggactcggtgttc
cgcacccgcggttccggcgtctcgtcggatgtggagaacaccatcgtcccgcagttgctc
agcgagatcgacggcgtcgagggcctggagaacgtcatcgtcatcggcgcctccaatcgg
gaggacatgattgacccggcgatcctgcggccgggccggcttgacgtcaaaatcaagatt
gagaggccggacgccgaggcggcgaaggacatcttctccaagtacatcctctccggactg
cccctgcatccggatgacctggccgagcacggtggtgagccacaggccaccgtggcggcg
atgatcgacgcggtcgtcctgcggatgtactcggagaccgaggagaaccgcttcctcgag
gtcacctacgccaacggcgacaaggatgtcctctacttcaaggacttcaactccggggcg
atgatccagaacatcgtggaccggggcaagaagatggccatcaaggagtttctcacctcc
gcccgcaagggcctgcggctgcaacacctcctcgacgcctgcgtcgacgagttccgggag
aacgaggacctgcccaacaccaccaaccctgacgactgggcgcgcatctccggcaagaag
ggcgagcggatcgtctacatccgcacgctcgtctccggcggcaagggcgccgacgcgggc
cggtccatcgagaccgccagcaacaccggtcagtacctctga

DBGET integrated database retrieval system