KEGG   Salinispora arenicola: Sare_2363Help
Entry
Sare_2363         CDS       T00613                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
saq  Salinispora arenicola
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Acarbose and validamycin biosynthesis
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sare_2363
   01055 Biosynthesis of vancomycin group antibiotics
    Sare_2363
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sare_2363
   00525 Acarbose and validamycin biosynthesis
    Sare_2363
Enzymes [BR:saq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     Sare_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2718026..2719000)
Genome map
AA seq 324 aa AA seqDB search
MRILVTGGAGFIGSAYVRRLLSGSEPALRPDQVTVLDSFTYAGTDGSLGPVRDDPRLRVV
RGDVRDEDLVDATVAGHDAIVHFAAESHVDRSIASAAPFVSTNVGGTQVLLDAALRHRTG
RFLHVSTDEVYGSISQGTSPPSAPLNPSSPYSATKAAADLLALAYHRTHGLDVVITRGAN
NYGPYQHPEKLIPRFVTNLFEGHTLPLYGDGGDIRDWLHVDDHCHGIALAQRNGRAGAIY
HLGGGTALTNRDLTAALLDLFDVGWDRVTPVTDRKGHDRRYALDTTATRRDLGWAPAVAL
DRGLTATVRWYREHRAWWEPLVKA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgagaatcctcgtcactggcggggctggcttcatcggctcagcgtacgtgcgccggctg
ctctccggctccgaacccgccctgcggccggaccaggtaaccgtgctcgactcgttcacc
tatgccggcaccgatggcagtctcggccccgtccgcgacgacccccgcctgcgtgtcgtc
cgtggtgatgtgcgcgacgaggatctggtcgacgccaccgtcgccggacacgacgccatc
gtccacttcgccgctgaatcccacgtggaccgctccatcgccagtgcggccccgttcgtc
agcaccaatgtgggcggcacccaggtcctgctcgacgccgcgctgcgtcaccgcaccggc
cgcttcctccacgtctccaccgatgaggtgtacgggtccatcagccagggcacgtcgccc
ccttccgcgccgctgaacccgagttccccgtactcggccaccaaggctgccgccgacctg
ttggccctggcctaccaccgcacccacggacttgacgtggtgatcacccggggtgccaac
aactacggtccctaccagcaccccgagaagctgatcccccgcttcgtcaccaacctgttc
gagggacacaccctgccgctgtacggcgacggcggcgacatccgcgactggctgcacgtg
gacgaccactgccacggaatcgcgctggcgcaacggaacggccgggccggggcgatctac
cacctcggcggcggcactgccctgaccaaccgggatctgaccgccgcgctgctcgacctg
ttcgacgttggttgggaccgggtgacaccggtgaccgaccgaaagggccacgaccgcagg
tacgccctcgacaccaccgcgacccgtcgcgacctcggatgggcaccagccgtcgccctc
gatcgaggcctgaccgccaccgtcaggtggtaccgggagcaccgggcctggtgggagccg
ctggtcaaggcgtag

DBGET integrated database retrieval system