KEGG   Salinispora arenicola: Sare_2365Help
Entry
Sare_2365         CDS       T00613                                 

Definition
(GenBank) hypothetical protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2720529..2720714
Genome map
AA seq 61 aa AA seqDB search
MMPTNPGGPGSEKQSWVERRRQKIRAEIERNRRGEYTVPTWVLALALGAIVVAWGALVIF
A
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctaccaacccgggcggtcccggctccgagaagcagagctgggtcgagcgccgc
cgccagaagatccgtgcggagatcgaacgtaaccgccgcggcgagtacacggtgcccacc
tgggtgctggcgctcgccctgggcgcgatcgtggtggcctggggcgcgttggtgatcttc
gcctga

DBGET integrated database retrieval system