KEGG   Salinispora arenicola: Sare_2366Help
Entry
Sare_2366         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
Organism
saq  Salinispora arenicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2720722..2721807)
Genome map
AA seq 361 aa AA seqDB search
MVRWRSATVTAVRREWKGAVELDVTLVDGAAVRALAYPELVGRPQAGDRVLLNVNALLMG
LGTGGYALVVALPDRLPPDPPTPAESRAAGHLVKARYTPLQPILLGVDEEASPHRAALAD
ADDLSGLPVVTADLHSALPAVLAGIRADTPNARVAYLLTDGGALPAWFSRTLAGLREHLV
GTISVGQAFGGDLEAGTLHAGLLAARHVLHADLAVVAQGPGNLGTGTRWGFSGVAVGEAV
NAIAALGGRPVGSLRISAADARPRHRGVSHHSLTAYGRVALASAELVVPDQLDPALATTV
EVALAPLAARHRVRRVPVDGLDAALRASPVPLSTMGRGLDADYAYFLAAAAAGRHAARLA
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgatggcggtcagcaacggtgacggcggttcggcgagaatggaagggcgcggtc
gaactggacgtcaccctcgtcgacggcgctgcggtacgcgccctcgcctaccccgaactg
gtcggccggccccaagccggagaccgcgtgttgctcaacgtgaacgccctgctgatgggt
ctcggtaccggcggatacgccttggtcgtggccctgccggaccggctaccaccggatcca
cccacaccagcggaaagccgtgccgcgggtcacctggtcaaggcccgctacaccccgtta
cagccgatcctgctcggcgtcgacgaggaggcatccccgcaccgagccgccctggccgac
gccgacgatctgtccggcctgcccgtggtcaccgccgacctgcactccgccctcccggcg
gttcttgccggaatccgtgccgacacaccgaacgcacgggtggcgtacctgctcaccgac
ggtggcgcgctgccagcgtggttctcccgtaccctcgccgggctccgcgagcacctggtc
ggcacgatcagcgtcggccaggcgttcggcggggacctggaggccggcaccctgcacgcc
ggcctgctcgccgcccgacatgtgctccacgccgacctggccgtcgtcgcccagggaccc
ggcaacctgggtaccggcacgcggtggggcttctccggagtagcagtcggcgaggcggtc
aacgcaatcgccgcactgggtggacggccggtcggatcactccggatctccgccgccgac
gcccgtcctcgacaccgtggcgtgtcccaccacagtctgaccgcgtacggtcgggtggcg
ttggccagcgccgagttggtggttcccgaccaactcgacccggcgctggcgacaacggtc
gaggtggcgctggccccactcgccgcccggcaccgcgtgcgccgggtgccggttgacggg
ctcgacgccgcgctgcgagccagcccggtgccactgtcaacgatgggccgcggtctggac
gccgactacgcctacttcctcgcggctgcggcagccggccggcatgccgcgcgactcgcc
ggctga

DBGET integrated database retrieval system