KEGG   Salinispora arenicola: Sare_2371Help
Entry
Sare_2371         CDS       T00613                                 

Definition
(GenBank) Sec-independent protein translocase, TatC subunit
  KO
K03118  
sec-independent protein translocase protein TatC
Organism
saq  Salinispora arenicola
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Brite
KEGG Orthology (KO) [BR:saq00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Sare_2371
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Sare_2371
Secretion system [BR:saq02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   Sare_2371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2724741..2725694
Genome map
AA seq 317 aa AA seqDB search
MAFALRKRGPSSFQRASEGSMTLVEHVRELRDRLFRASLAVVAGLIVGFVLAQPAFDLLK
EPYCNLPDSTNADGVCQGFLQLSPADGFLLKLKLALWIGLIVAAPVWLYQLWAFIAPGLH
RHERKWAYVFVAIAAPLFAGGAVLAYLVVDKGLAFLMESGVTGLSTQLEVTRYISFVTTM
ILLFGVAFEFPLILLMLNFTGVATARRLLSWWRVVIFVCFAFAAIATPDPGPFGMTLLAL
SLSLLYFVAVGVAFLNDRRRGRGKEIYAGLADDEVSPLKDDNEPIEASAPVGAPDSIAEP
EPVAKPAPIERRYDDMT
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtggcctttgccctgcgtaaacgcggcccgagcagcttccagcgggcctcggaaggctcg
atgaccctggtcgagcacgtccgcgagttgcgcgaccggctgttccgcgcgtcgctggct
gtcgtcgccggcctgattgtcggttttgtccttgcgcaaccggcattcgatctgctgaaa
gagccctactgcaacctcccggactccacgaacgcggacggggtgtgccaggggttcctg
cagctgtccccagcggacgggttcctcctcaagctcaagctggccctgtggatcggcctg
atcgtcgcggcaccagtctggctctatcagctctgggcgttcatcgcgccgggtctgcac
cggcacgagcgtaaatgggcgtacgtcttcgtcgccatcgccgccccgctcttcgccggt
ggcgccgtcctcgcctacctggtggtggacaagggcctggcgtttctcatggaatccggt
gtcaccgggctgtccacgcaactcgaggtgacccgctacatctcgttcgtcacgaccatg
atcctgctctttggggtggcgttcgagtttcccctgatcctgctgatgttgaacttcacc
ggggtggccaccgcgcggcggctgctcagctggtggcgcgtggtgatcttcgtctgcttc
gccttcgccgccatcgcgaccccggatccggggcccttcgggatgacgttgctcgccctg
tcgctgtcgctgctgtacttcgtcgccgtgggcgtcgcgttcctcaacgacagacgtcgg
gggcgcggtaaggagatctacgcaggcctcgccgacgacgaggtgtcgccgctgaaggac
gacaacgagccgatcgaggccagtgccccggtcggcgcgcccgactcgatcgcggagccc
gagccggttgccaagcccgcgccgatcgagcgtcgctacgacgacatgacctga

DBGET integrated database retrieval system