KEGG   Salinispora arenicola: Sare_2382Help
Entry
Sare_2382         CDS       T00613                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K18012  
L-erythro-3,5-diaminohexanoate dehydrogenase [EC:1.4.1.11]
Organism
saq  Salinispora arenicola
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:saq00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Sare_2382
Enzymes [BR:saq01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.11  L-erythro-3,5-diaminohexanoate dehydrogenase
     Sare_2382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2737065..2738123
Genome map
AA seq 352 aa AA seqDB search
MSPVGLHRVLEPAGVLPQAAWRLDADPVIAPNEVRIRVERLNLDAASFRQLREKHGGDGA
RVRAEVLEIIAARGKMQNPVTGSGGMLIGTVEEAGRRSPLGLRVGDRVATLVSLTLTPLA
VTDRLARWDGRSEQVPCDGHAILFARSVAAVLPADVDPGLSLAVLDVCGAPALTARVVQR
YVADRAREADARPVSVAVIGGAGKSGSLSLAAARRAGAARTVGVVPVVGERDALAAAGVA
DVVAVADARDPVVLSTAVTSALGAPADVTVVCVDVPGCEHGAVLATADGGTVVFFSMATS
FAGAALGAEGLAADVTMLVGNGYVPGHAEFALGLLRAEPGVRRLFEARVAAD
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccggtgggtctgcaccgtgtcctggagcccgcgggggtgctaccgcaagcggct
tggcgactggacgcggacccggtcatcgccccgaacgaggtgcggatccgggtggagcgg
ttgaacctggacgcggcgagtttccgtcagctgagggagaaacacggcggggatggcgca
cgggtccgcgccgaggttctggagatcatcgctgcgcggggaaagatgcagaacccggtg
accggctcgggcggcatgttgatcggcacggtcgaggaggcgggccggcggtcgccgttg
ggcctgcgggtgggcgaccgggtggcaactctggtatcgctcaccctgacgccgctggcc
gtcacggaccggctggcccgctgggatgggcgcagtgagcaggtcccgtgtgacggacat
gcgatcctgttcgcccgctctgtcgcggcggtgttgccggcggatgtggatccggggttg
tccctcgcggtgttggacgtgtgtggggctccggcgttgaccgcgcgggtggtgcagcgg
tatgtggcggaccgggcgcgggaggcagacgctcgaccggtcagcgttgcggtgattggt
ggtgcgggcaagagcgggtcgctgtcgctggccgcagcccggcgggcgggggcggcccga
actgtcggggtggttccggtggtgggggaacgggacgcgttggcggcggccggggtagcg
gatgtggtggcggtggccgacgcgcgggatccggtggtgttgtcgacggcggtgacgtcg
gcgctgggggctccggcggatgtgacggtggtgtgtgtggacgtgccgggctgtgagcac
ggggcggtgttggccacggccgacggcggcacggtggtgttcttctcgatggcgacgagt
ttcgcgggggcggctttgggggcggagggcttggcggcggatgtgacgatgctggtcggt
aacgggtatgtgccgggccacgcggagttcgcgctgggtctgctgcgggccgaaccgggg
gtgcgtcgtctgttcgaggcgcgggtggcggcagactga

DBGET integrated database retrieval system